Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000058806 (Col13a1)
Chromosomal location
Chr 10: 61300984 - 61441856 (-)
Description
collagen, type XIII, alpha 1 Gene [Source:MGI (curated);Acc:Col13a1-005]
RefSeq_dna
NM_007731 
RefSeq_peptide
NP_031757.1 
UniGene
Mm.300931 
MGI
MGI:1277201 
Uniprot/SWISSPROT
Q9R1N9 
Uniprot/SPTREMBL
Q8K036 Q8CD80 
Human Ortholog
ENSG00000197467 (COL13A1)
Omim not available
UniTrap UNI19923
Vector Insertion
Chr 10: 61382845 - 61424036
Public Clones IST10327F11 (tigm) IST12964D4 (tigm) IST14626B10 (tigm) IST10080E6 (tigm)
IST10949D4 (tigm) IST10080E5 (tigm) IST10080D6 (tigm) IST10235H11 (tigm)
IST14499H2 (tigm) IST12553E9 (tigm) IST14358D9 (tigm)
Private Clones OST377080 (lexicon) OST309567 (lexicon)
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26109
Vector Insertion
Chr 10: 61371466 - 61374454
Public Clones not available
Private Clones OST137108 (lexicon)
Severity of mutation (?) Insertion after 23% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20163
Vector Insertion
Chr 10: 61365889 - 61368001
Public Clones not available
Private Clones OST370927 (lexicon) OST111105 (lexicon)
Severity of mutation (?) Insertion after 25% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37902
Vector Insertion
Chr 10: 61352826 - 61354013
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21464
Vector Insertion
Chr 10: 61313859 - 61313914
Public Clones not available
Private Clones OST329543 (lexicon)
Severity of mutation (?) Insertion after 84% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000048320
Sequence
GGCTGTGTCAAGTTACAGAGGCGCCAGAATCGGCCCCAGCGCGGCTCACTGCAGCCACGACCCACCTCTGCCCATGGGGCCCTGCATGCGTGCCCCTTCG

CCCGGGGACTGACACCCGTTCTCCCCGGAGACACAAAACACCCAGAAGGACCCCGAGCGTCGCACCAGCCCGAGAACTCTGCAGAAGAGAGAAGGGAAAG

AGTGGGGAGCGGGGCCAGATCCCCGAACTTGGAACATTCTTCGAAATAACTTTTTTCTTACTTTGGCGTACTCCGATCGCGTCTGCTGGTGGCTCTTGGC

TGCTCCCGACTCCGACTGCTCATTTTCGGTCCTCTTTGGCGAGCAAAGGAAAGGGACGTCCTCTAGCCACGTTAACCCCCTTTCCCCTTGCCTCTCAGTT

TGGATCGCGCCTCTTGGATCTCGTTTTTATTTATTCTATTTATTTATTTATTGGCTCTCAAGACGCGAGGGCATGGTGGCGGAGCGCACCCGCAAAGCGG

CAGCCTCTGGCAGCCGCGGCCCTGGGGAGCTGGGCGCTCCGGGGCCCGGGACAGTGGCGCTGGCTGAGCAGTGCGCTAGGCTGCCGAGCCCCGGGTGCTG

CGGACTGCTGGCTCTAGCGCTGTGTTCGCTGGCGCTCAGCCTGCTCGCCCACTTTCGGACCGCGGAGCTGCAGGCCCGGGTGCTGCGCTTGGAAGCAGAG

CGCGGGGAGCAGCAGATGGAGAAAGCTATTTTGGGACGAGTCAACCAACTGCTGGACGAG AAATGGAAGTTCTACTCGCGTAGGCGCCGGGAAGCCCCG

AAGATGTCTCCAGGATGTAACTGCCCACCAG - UNI19923 - GACCTCCT GGTCCCACTGGAAGACCTGGACTCCCA - UNI26109 - GGGGA

CAAGGGTGCCATCGGGATGCCTGGACGTGTG - UNI20163 - GGTGCCCCTGGAGATGCGGGGATGTCCATCGTCGGGCCTCGAGGCCCCCCT GGC

CAGCCTGGTACCCGAGGTTTCCCTGGATTCCCG GGTCCCATTGGTCTTGACGGCAGGCCG GGCCACCCCGGACCTAAAGGGGAGATG GGCCTGGTGG

GTCCTCGAGGACAACCG GGACCTCAGGGACAAAAGGGAGAAAAG GGTCAGTGTGGAGAGTACCCACACAGG GAGTACCCAGGCGGCATGCTAGCAGC

TCTGCGCTCCAACCCGATAATGTCCCTAAAG GGGGAACAAAGTCAGACTGGCATCCAAGGCCCTCCAGGGCCACCGGGCCCCCCAGGACCAAGTGGCCC

TCTGGGACACCCAGGACTGCCAGGGCCTATAGGGCCACCT GGTTTACCGGGGCCTCCTGGACCAAAG GGAGACCCAGGGATCCAGGGCTATCATGGCC

GCAAG GGAGAGCGGGGCATGCCAGGAATGCCAGGCAAGCACGGAGCCAAG GGGGTTCCTGGGATTGCCGTGGCTGGGATGAAG GGTGAGCCAGGGAC

GCCAGGAACCAAG GGTGAGAAGGGTGCAGCAGGCTCCCCTGGCCTCCTGGGGCAGAAG GGAGAAAAAGGTGATGCTGGCAATGCCATCGGAGGAGGCA

GGGGGGAGCCTGGCCCCCCGGGGCTCCCTGGGCCCCCTGGGCCAAAG GGAGAAGCTGGTGTTGATGGCCAGGCTGGGCCCCCAGGACAGCAAGGAGACA

AG GGGCAGCCAGGAGCAGCTGGTGAACAGGGACCCTCTGGCCCCAAG GGTGCCAAGGGTGAACCCGGCAAAGGAGAGATGGTGGATTATAATGGCAGC

ATCAACGAGGCGCTTCAG GAGATCAGGACGCTGGCCTTGATG GGGCCTCCTGGTCTTCCTGGACAAACAGGCCCACCCGGACCTCCAGGGACTCCAGG

CCAAAGG GGGGAGATTGGACTGCCAGGCCCTCCAGGACACGATGGGGACAAG GGGCCTCGAGGAAAACCAGGAGAT GCCGGCTGGTCCTCAAGGACC

CCCAGGAAAGGATGGGCCTCCAGGAATGAAGGGAGAAGTCGGACCCCCAGGAAGTCCAGGGGAGAAAGGGGAGACAGGACAAGCAGGCCCCCAG GGAGA

GAAAGGAGAAGCTGGGGAGAAAGGCGACCCGGGAGCAGAG GTTCCTGGGCCGCCAGGGCCAGAGGGTCCTCCAGGACCTCCG GGCCTCCAAGGTTTTC

CTGGACCAAAG GGAGAAGCAGGCCTAGAGGGCAGTAAAGGAGAGAAGGGCTCCCAGGGAGAAAAAGGAGACCGGGGGCCTCTGGGATTGCCT - UNI2

1464 - GGTACTCCAGGACCAATCGGGGTTCCAGGCCCAGCCGGACCAAAGGGCGAAAGG - UNI21464 - GGCAGCAAAGGCGACCCAGGGATGA

CGGGACCAACGGGAGCAGCTGGGCTGCCT GGTTTACATGGACCACCCGGGGACAAAGGAAACCGG GGGGAGAGGGGGAAGAAGGGCTCTAGAGGGCCT

AAAGGGGACAAGGGGGACCAAGGAGCACCTGGACTAGACGCCCCCTGCCCGCTG GGAGAAGATGGCTTACCAGTCCAAGGCTGCTGGAACAAG TGATG

CCTCTAACCTGGGACTGGCCTGTGTGTGTTTGTATATAGGATATTTATTTTTATACAGTTTTCACCTTTTGAAAATGCCCAAACTATGATGCATCTTACA

GATCATTAAGAAAGAAAGAAGAAAAGCCTGCAGATTTTGTACAGGAAATAACCCCTTTCCCTTTTTGTTTACAAGACATTTTTGTATAAATCTGTTTCTA

ATACAC
Translation
MVAERTRKAAASGSRGPGELGAPGPGTVALAEQCARLPSPGCCGLLALALCSLALSLLAHFRTAELQARVLRLEAERGEQQMEKAILGRVNQLLDE KWK

FYSRRRREAPKMSPGCNCPPG - UNI19923 - GPP GPTGRPGLP - UNI26109 - GDKGAIGMPGRV - UNI20163 - GAPGDAGMSIVG

PRGPP GQPGTRGFPGFP GPIGLDGRP GHPGPKGEM GLVGPRGQP GPQGQKGEK GQCGEYPHR EYPGGMLAALRSNPIMSLK GEQSQTGIQGP

PGPPGPPGPSGPLGHPGLPGPIGPP GLPGPPGPK GDPGIQGYHGRK GERGMPGMPGKHGAK GVPGIAVAGMK GEPGTPGTK GEKGAAGSPGLLG

QK GEKGDAGNAIGGGRGEPGPPGLPGPPGPK GEAGVDGQAGPPGQQGDK GQPGAAGEQGPSGPK GAKGEPGKGEMVDYNGSINEALQ EIRTLALM

 GPPGLPGQTGPPGPPGTPGQR GEIGLPGPPGHDGDK GPRGKPGD AGWSSRTPRKGWASRNEGRSRTPRKSRGERGDRTSRPPG GRERRSWGERRP

GSRG GSWAARARGSSRTSG GPPRFSWTKG GRSRPRGQ - UNI21464 -  - UNI21464 -     
Transcript ENSMUST00000105450
Sequence
GGCTGTGTCAAGTTACAGAGGCGCCAGAATCGGCCCCAGCGCGGCTCACTGCAGCCACGACCCACCTCTGCCCATGGGGCCCTGCATGCGTGCCCCTTCG

CCCGGGGACTGACACCCGTTCTCCCCGGAGACACAAAACACCCAGAAGGACCCCGAGCGTCGCACCAGCCCGAGAACTCTGCAGAAGAGAGAAGGGAAAG

AGTGGGGAGCGGGGCCAGATCCCCGAACTTGGAACATTCTTCGAAATAACTTTTTTCTTACTTTGGCGTACTCCGATCGCGTCTGCTGGTGGCTCTTGGC

TGCTCCCGACTCCGACTGCTCATTTTCGGTCCTCTTTGGCGAGCAAAGGAAAGGGACGTCCTCTAGCCACGTTAACCCCCTTTCCCCTTGCCTCTCAGTT

TGGATCGCGCCTCTTGGATCTCGTTTTTATTTATTCTATTTATTTATTTATTGGCTCTCAAGACGCGAGGGCATGGTGGCGGAGCGCACCCGCAAAGCGG

CAGCCTCTGGCAGCCGCGGCCCTGGGGAGCTGGGCGCTCCGGGGCCCGGGACAGTGGCGCTGGCTGAGCAGTGCGCTAGGCTGCCGAGCCCCGGGTGCTG

CGGACTGCTGGCTCTAGCGCTGTGTTCGCTGGCGCTCAGCCTGCTCGCCCACTTTCGGACCGCGGAGCTGCAGGCCCGGGTGCTGCGCTTGGAAGCAGAG

CGCGGGGAGCAGCAGATGGAGAAAGCTATTTTGGGACGAGTCAACCAACTGCTGGACGAG AAATGGAAGTTCTACTCGCGTAGGCGCCGGGAAGCCCCG

AAGATGTCTCCAGGATGTAACTGCCCACCAG - UNI19923 - TCTTTCAGGGTCCCACTGGAAGACCTGGACTCCCA - UNI26109 - GGGGAC

AAGGGTGCCATCGGGATGCCTGGACGTGTG - UNI20163 - GGTGCCCCTGGAGATGCGGGGATGTCCATCGTCGGGCCTCGAGGCCCCCCT GGCC

AGCCTGGTACCCGAGGTTTCCCTGGATTCCCG GGTCCCATTGGTCTTGACGGCAGGCCG GGCCACCCCGGACCTAAAGGGGAGATG GGCCTGGTGGG

TCCTCGAGGACAACCG GGACCTCAGGGACAAAAGGGAGAAAAG GGTCAGTGTGGAGAGTACCCACACAGG GGGGAACAAAGTCAGACTGGCATCCAA

GGCCCTCCAGGGCCACCGGGCCCCCCAGGACCAAGTGGCCCTCTGGGACACCCAGGACTGCCAGGGCCTATAGGGCCACCT GGTTTACCGGGGCCTCCT

GGACCAAAG GGAGACCCAGGGATCCAGGGCTATCATGGCCGCAAG GGAGAGCGGGGCATGCCAGGAATGCCAGGCAAGCACGGAGCCAAG GGGGTTC

CTGGGATTGCCGTGGCTGGGATGAAG GGTGAGCCAGGGACGCCAGGAACCAAG GGTGAGAAGGGTGCAGCAGGCTCCCCTGGCCTCCTGGGGCAGAAG

 GGAGAAAAAGGTGATGCTGGCAATGCCATCGGAGGAGGCAGGGGGGAGCCTGGCCCCCCGGGGCTCCCTGGGCCCCCTGGGCCAAAG GGAGAAGCTGG

TGTTGATGGCCAGGCTGGGCCCCCAGGACAGCAAGGAGACAAG GGGCAGCCAGGAGCAGCTGGTGAACAGGGACCCTCTGGCCCCAAG GGTGCCAAGG

GTGAACCCGGCAAAGGAGAGATGGTGGATTATAATGGCAGCATCAACGAGGCGCTTCAG GAGATCAGGACGCTGGCCTTGATG GGGCCTCCTGGTCTT

CCTGGACAAACAGGCCCACCCGGACCTCCAGGGACTCCAGGCCAAAGG GGGGAGATTGGACTGCCAGGCCCTCCAGGACACGATGGGGACAAG GGGCC

TCGAGGAAAACCAGGAGATATGGGGCCGGCTGGTCCTCAAGGACCCCCAGGAAAGGATGGGCCTCCAGGAATGAAGGGAGAAGTCGGACCCCCAGGAAGT

CCAGGGGAGAAAGGGGAGACAGGACAAGCAGGCCCCCAG GGAGAGAAAGGAGAAGCTGGGGAGAAAGGCGACCCGGGAGCAGAG GTTCCTGGGCCGCC

AGGGCCAGAGGGTCCTCCAGGACCTCCG GGCCTCCAAGGTTTTCCTGGACCAAAG GGAGAAGCAGGCCTAGAGGGCAGTAAAGGAGAGAAGGGCTCCC

AGGGAGAAAAAGGAGACCGGGGGCCTCTGGGATTGCCT - UNI21464 - GGTACTCCAGGACCAATCGGGGTTCCAGGCCCAGCCGGACCAAAGGGC

GAAAGG - UNI21464 - GGCAGCAAAGGCGACCCAGGGATGACGGGACCAACGGGAGCAGCTGGGCTGCCT GGTTTACATGGACCACCCGGGGACA

AAGGAAACCGGGTAAGTCTGAGCCCTCGTGCTCTGCATCTGGTTACTAACGTCTTCATGATGGGATGGAATGATCAATTGGAGGCTCCTGACCTAACAGG

ACAAATGTTCTTTCCCTATAAATCATCCTAA
Translation
 MSPGCNCPPV - UNI19923 - VFQGPTGRPGLP - UNI26109 - GDKGAIGMPGRV - UNI20163 - GAPGDAGMSIVGPRGPP GQPGT

RGFPGFP GPIGLDGRP GHPGPKGEM GLVGPRGQP GPQGQKGEK GQCGEYPHR GEQSQTGIQGPPGPPGPPGPSGPLGHPGLPGPIGPP GLPGP

PGPK GDPGIQGYHGRK GERGMPGMPGKHGAK GVPGIAVAGMK GEPGTPGTK GEKGAAGSPGLLGQK GEKGDAGNAIGGGRGEPGPPGLPGPPGP

K GEAGVDGQAGPPGQQGDK GQPGAAGEQGPSGPK GAKGEPGKGEMVDYNGSINEALQ EIRTLALM GPPGLPGQTGPPGPPGTPGQR GEIGLPGP

PGHDGDK GPRGKPGDMGPAGPQGPPGKDGPPGMKGEVGPPGSPGEKGETGQAGPQ GEKGEAGEKGDPGAE VPGPPGPEGPPGPP GLQGFPGPK GE

AGLEGSKGEKGSQGEKGDRGPLGLP - UNI21464 - GTPGPIGVPGPAGPKGER - UNI21464 - GSKGDPGMTGPTGAAGLP GLHGPPGDKG

NRVSLSPRALHLVTNVFMMGWNDQLEAPDLTGQMFFPYKSS
Transcript ENSMUST00000051826
Sequence
ACGCGCGCGGCGGTCAGGTGGAGAAAAGCAGGGCGCGCAAAAGGTGCGCAGAGGCCGCCAGGGCTGGTTGCGGGAAATAGTCTGGGTGCACGCTTGCAGG

GGGGCTCTGGTGGCCCTGTCCGCTCCACGAGGGTGAGTGCTGCCTGGTTTTATGGTCACATTTGGAAGCAGGGAAAGAGAGTGAGCCATTTAAGGACCTA

AAGGGACAATTTCTAAAGTGGATTGCTCTTTGCTGGTCCCTGTTTGCTGTTTCTGGCCCCTAGGGCCCAAGTGTGAGTTTCCTGGCTCAGTCCTCCTCAG

GGTCCCGTTAACCTATGACTCTTCCGGCTGTGGCCTCTGGAATGATCCTAACTCAATCCCTGCAACTGCGGAAAGGATGCAGCTCTCTCTCAAAAGTCTC

CCTTCCCAG AAATGGAAGTTCTACTCGCGTAGGCGCCGGGAAGCCCCGAAGATGTCTCCAGGATGTAACTGCCCACCAG - UNI19923 - GACCTC

CT GGTCCCACTGGAAGACCTGGACTCCCA - UNI26109 - GGGGACAAGGGTGCCATCGGGATGCCTGGACGTGTG - UNI20163 - GGTGCC

CCTGGAGATGCGGGGATGTCCATCGTCGGGCCTCGAGGCCCCCCT GGCCAGCCTGGTACCCGAGGTTTCCCTGGATTCCCG GGTCCCATTGGTCTTGA

CGGCAGGCCG GGCCACCCCGGACCTAAAGGGGAGATG GGCCTGGTGGGTCCTCGAGGACAACCG GGACCTCAGGGACAAAAGGGAGAAAAG GGTCA

GTGTGGAGAGTACCCACACAGG GGGGAACAAAGTCAGACTGGCATCCAAGGCCCTCCAGGGCCACCGGGCCCCCCAGGACCAAGTGGCCCTCTGGGACA

CCCAGGACTGCCAGGGCCTATAGGGCCACCT GGTTTACCGGGGCCTCCTGGACCAAAG GGAGACCCAGGGATCCAGGGCTATCATGGCCGCAAG GGA

GAGCGGGGCATGCCAGGAATGCCAGGCAAGCACGGAGCCAAG GGGGTTCCTGGGATTGCCGTGGCTGGGATGAAG GGTGAGCCAGGGACGCCAGGAAC

CAAG GGTGAGAAGGGTGCAGCAGGCTCCCCTGGCCTCCTGGGGCAGAAG GGAGAAAAAGGTGATGCTGGCAATGCCATCGGAGGAGGCAGGGGGGAGC

CTGGCCCCCCGGGGCTCCCTGGGCCCCCTGGGCCAAAG GGAGAAGCTGGTGTTGATGGCCAGGCTGGGCCCCCAGGACAGCAAGGAGACAAG GGGCAG

CCAGGAGCAGCTGGTGAACAGGGACCCTCTGGCCCCAAG GGTGCCAAGGGTGAACCCGGCAAAGGAGAGATGGTGGATTATAATGGCAGCATCAACGAG

GCGCTTCAG GAGATCAGGACGCTGGCCTTGATG GGGCCTCCTGGTCTTCCTGGACAAACAGGCCCACCCGGACCTCCAGGGACTCCAGGCCAAAGG G

GGGAGATTGGACTGCCAGGCCCTCCAGGACACGATGGGGACAAG GGGCCTCGAGGAAAACCAGGAGATATGGGGCCGGCTGGTCCTCAAGGACCCCCAG

GAAAGGATGGGCCTCCAGGAATGAAGGGAGAAGTCGGACCCCCAGGAAGTCCAGGGGAGAAAGGGGAGACAGGACAAGCAGGCCCCCAG GGAGAGAAAG

GAGAAGCTGGGGAGAAAGGCGACCCGGGAGCAGAG GTTCCTGGGCCGCCAGGGCCAGAGGGTCCTCCAGGACCTCCG GGCCTCCAAGGTTTTCCTGGA

CCAAAG GGAGAAGCAGGCCTAGAGGGCAGTAAAGGAGAGAAGGGCTCCCAGGGAGAAAAAGGAGACCGGGGGCCTCTGGGATTGCCT - UNI21464 

- GGTACTCCAGGACCAATCGGGGTTCCAGGCCCAGCCGGACCAAAGGGCGAAAGG - UNI21464 - GGCAGCAAAGGCGACCCAGGGATGACGGGA

CCAACGGGAGCAGCTGGGCTGCCT GGTTTACATGGACCACCCGGGGACAAAGGAAACCGGGTAAGTCTGAGCCCTCGTGCTCTGCATCTGGTTACTAAC

GTCTTCATGATGGGATGGAATGATCAATTGGAGGCTCCTGACCTAACAGGACAAATGTTCTTTCCCTATAAATCATCCTAAATTGAAAGGCTTTCTAACG

AGGGGCTCCATGCCATACACGCAGGGAACCTGAGGCCCAGTACTACAGTTGAAGCCAGTATTTCTCATTTCCAGAGAAGGCTCAGTGAATCTCACAGCAG

CCATCAGATTAGCATGGCCATCTAGTAACAGGAGCCTCTCATCCAGCTCTCTCTACGTTGCCCTGATAACCGGCCCCTTAGTGATATTTTTAGATCCATC

GTCACCTCATCTTTGCCTCCTGAAACTGAGATTTGTCAGGCATTCCAGGCCACTATTGGTGACTGAGAAAATAAATTCCAGCTCTGAGAACAGCCAGCCA

AGCCC
Translation
MQLSLKSLPSQ KWKFYSRRRREAPKMSPGCNCPPG - UNI19923 - GPP GPTGRPGLP - UNI26109 - GDKGAIGMPGRV - UNI20163

 - GAPGDAGMSIVGPRGPP GQPGTRGFPGFP GPIGLDGRP GHPGPKGEM GLVGPRGQP GPQGQKGEK GQCGEYPHR GEQSQTGIQGPPGPPG

PPGPSGPLGHPGLPGPIGPP GLPGPPGPK GDPGIQGYHGRK GERGMPGMPGKHGAK GVPGIAVAGMK GEPGTPGTK GEKGAAGSPGLLGQK GE

KGDAGNAIGGGRGEPGPPGLPGPPGPK GEAGVDGQAGPPGQQGDK GQPGAAGEQGPSGPK GAKGEPGKGEMVDYNGSINEALQ EIRTLALM GPPG

LPGQTGPPGPPGTPGQR GEIGLPGPPGHDGDK GPRGKPGDMGPAGPQGPPGKDGPPGMKGEVGPPGSPGEKGETGQAGPQ GEKGEAGEKGDPGAE V

PGPPGPEGPPGPP GLQGFPGPK GEAGLEGSKGEKGSQGEKGDRGPLGLP - UNI21464 - GTPGPIGVPGPAGPKGER - UNI21464 - GSK

GDPGMTGPTGAAGLP GLHGPPGDKGNRVSLSPRALHLVTNVFMMGWNDQLEAPDLTGQMFFPYKSS
Transcript ENSMUST00000105451
Sequence
ACAGAATAGATCTAGGCTGAGCTCACTCTGCAGCACGGACTCAGAGAGGAAAACAGTCACCCTGACACCTAGCCCGGCTCCACACGGGGGAGATAGAAGG

GAGTTCAGAGACCTTGCAGAAAGCTAAGGAACCAACAAAAACCAGAAGGGAAGAGAGACAAACCGAAGCCTCTGAATAGCCAGGACCTCCCAAG GGAGA

GCGGGGCATGCCAGGAATGCCAGGCAAGCACGGAGCCAAG GGGGTTCCTGGGATTGCCGTGGCTGGGATGAAG GGTGAGCCAGGGACGCCAGGAACCA

AG GGTGAGAAGGGTGCAGCAGGCTCCCCTGGCCTCCTGGGGCAGAAG GGAGAAAAAGGTGATGCTGGCAATGCCATCGGAGGAGGCAGGGGGGAGCCT

GGCCCCCCGGGGCTCCCTGGGCCCCCTGGGCCAAAG GGAGAAGCTGGTGTTGATGGCCAGGCTGGGCCCCCAGGACAGCAAGGAGACAAG GGGCAGCC

AGGAGCAGCTGGTGAACAGGGACCCTCTGGCCCCAAG GGTGCCAAGGGTGAACCCGGCAAAGGAGAGATGGTGGATTATAATGGCAGCATCAACGAGGC

GCTTCAG GAGATCAGGACGCTGGCCTTGATG GGGCCTCCTGGTCTTCCTGGACAAACAGGCCCACCCGGACCTCCAGGGACTCCAGGCCAAAGG GGG

GAGATTGGACTGCCAGGCCCTCCAGGACACGATGGGGACAAG GGGCCTCGAGGAAAACCAGGAGATATGGGGCCGGCTGGTCCTCAAGGACCCCCAGGA

AAGGATGGGCCTCCAGGAATGAAGGGAGAAGTCGGACCCCCAGGAAGTCCAGGGGAGAAAGGGGAGACAGGACAAGCAGGCCCCCAG GGTCTAGACGGC

CCAACTGGGGAGAAAGGAGAACCAGGTGACGAAGGGAGGCCTGGAGCGACAGGATTGCCTGGGCCCATCGGGCTCCCGGGATTCACA GGAGAGAAAGGA

GAAGCTGGGGAGAAAGGCGACCCGGGAGCAGAG GTTCCTGGGCCGCCAGGGCCAGAGGGTCCTCCAGGACCTCCG GGCCTCCAAGGTTTTCCTGGACC

AAAG GGAGAAGCAGGCCTAGAGGGCAGTAAAGGAGAGAAGGGCTCCCAGGGAGAAAAAGGAGACCGGGGGCCTCTGGGATTGCCT GGAGCTTCAGGTT

TGGACGGCAGGCCTGGGCCACCG - UNI21464 - GGTACTCCAGGACCAATCGGGGTTCCAGGCCCAGCCGGACCAAAGGGCGAAAGG - UNI214

64 - GGCAGCAAAGGCGACCCAGGGATGACGGGACCAACGGGAGCAGCTGGGCTGCCT GGTTTACATGGACCACCCGGGGACAAAGGAAACCGG GGG

GAGAGGGGGAAGAAGGGCTCTAGAGGGCCTAAAGGGGACAAGGGGGACCAAGGAGCACCTGGACTAGACGCCCCCTGCCCGCTG GGAGAAGATGGCTTA

CCAGTCCAAGGCTGCTGGAACAAG TGATGCCTCTAACCTGGGACTGGCCTGTGTGTGTTTGTATATAGGATATTTATTTTTATACAGTTTTCACCTTTT

GAAAATGCCCAAACTATGATGCATCTTACAGATCATTAAGAAAGAAAGAAGAAAAGCCTGCAGATTTTGTACAGGAAATAACCCCTTTCCCTTTTTGTTT

ACAAGACATTTTTGTATAAATCTGTTTCTAATACACTTTCTGTCTGTGCGTCTGCTCCTAATGTTGCATGATATTTGTGCACACTTACTAAATATCACAG

CTTCATAAATTATTGTGTTCCAGTGCCAAAGGGGGCCCACCAGCACAGAGGTGCTGTGAGCTTGTGTGTGAATTCACACACACACACAAAAAAAGTGGAG

GTCGGTGGTGTTTGCCAGACTACATGTGTCTGACAATATTTTACATTTTAACTGACGGTCATTATTATAAGAAAAAAATAATAAAACGTGGCAATTCA
Translation
 MPGMPGKHGAK GVPGIAVAGMK GEPGTPGTK GEKGAAGSPGLLGQK GEKGDAGNAIGGGRGEPGPPGLPGPPGPK GEAGVDGQAGPPGQQGDK 

GQPGAAGEQGPSGPK GAKGEPGKGEMVDYNGSINEALQ EIRTLALM GPPGLPGQTGPPGPPGTPGQR GEIGLPGPPGHDGDK GPRGKPGDMGPAG

PQGPPGKDGPPGMKGEVGPPGSPGEKGETGQAGPQ GLDGPTGEKGEPGDEGRPGATGLPGPIGLPGFT GEKGEAGEKGDPGAE VPGPPGPEGPPGPP

 GLQGFPGPK GEAGLEGSKGEKGSQGEKGDRGPLGLP GASGLDGRPGPP - UNI21464 - GTPGPIGVPGPAGPKGER - UNI21464 - GSK

GDPGMTGPTGAAGLP GLHGPPGDKGNR GERGKKGSRGPKGDKGDQGAPGLDAPCPL GEDGLPVQGCWNK K
Transcript ENSMUST00000105453
Sequence
CCAGCGCGGCTCACTGCAGCCACGACCCACCTCTGCCCATGGGGCCCTGCATGCGTGCCCCTTCGCCCGGGGACTGACACCCGTTCTCCCCGGAGACACA

AAACACCCAGAAGGACCCCGAGCGTCGCACCAGCCCGAGAACTCTGCAGAAGAGAGAAGGGAAAGAGTGGGGAGCGGGGCCAGATCCCCGAACTTGGAAC

ATTCTTCGAAATAACTTTTTTCTTACTTTGGCGTACTCCGATCGCGTCTGCTGGTGGCTCTTGGCTGCTCCCGACTCCGACTGCTCATTTTCGGTCCTCT

TTGGCGAGCAAAGGAAAGGGACGTCCTCTAGCCACGTTAACCCCCTTTCCCCTTGCCTCTCAGTTTGGATCGCGCCTCTTGGATCTCGTTTTTATTTATT

CTATTTATTTATTTATTGGCTCTCAAGACGCGAGGGCATGGTGGCGGAGCGCACCCGCAAAGCGGCAGCCTCTGGCAGCCGCGGCCCTGGGGAGCTGGGC

GCTCCGGGGCCCGGGACAGTGGCGCTGGCTGAGCAGTGCGCTAGGCTGCCGAGCCCCGGGTGCTGCGGACTGCTGGCTCTAGCGCTGTGTTCGCTGGCGC

TCAGCCTGCTCGCCCACTTTCGGACCGCGGAGCTGCAGGCCCGGGTGCTGCGCTTGGAAGCAGAGCGCGGGGAGCAGCAGATGGAGAAAGCTATTTTGGG

ACGAGTCAACCAACTGCTGGACGAG AAATGGAAGTTCTACTCGCGTAGGCGCCGGGAAGCCCCGAAGATGTCTCCAGGATGTAACTGCCCACCAG - U

NI19923 - GACCTCCT GGTCCCACTGGAAGACCTGGACTCCCA - UNI26109 - GGGGACAAGGGTGCCATCGGGATGCCTGGACGTGTG - U

NI20163 - GGTGCCCCTGGAGATGCGGGGATGTCCATCGTCGGGCCTCGAGGCCCCCCT GGCCAGCCTGGTACCCGAGGTTTCCCTGGATTCCCG G

GTCCCATTGGTCTTGACGGCAGGCCG GGCCACCCCGGACCTAAAGGGGAGATG GGCCTGGTGGGTCCTCGAGGACAACCG GGACCTCAGGGACAAAA

GGGAGAAAAG GGTCAGTGTGGAGAGTACCCACACAGG GAGTACCCAGGCGGCATGCTAGCAGCTCTGCGCTCCAACCCGATAATGTCCCTAAAG GGG

GAACAAAGTCAGACTGGCATCCAAGGCCCTCCAGGGCCACCGGGCCCCCCAGGACCAAGTGGCCCTCTGGGACACCCAGGACTGCCAGGGCCTATAGGGC

CACCT GGTTTACCGGGGCCTCCTGGACCAAAG GGAGACCCAGGGATCCAGGGCTATCATGGCCGCAAG GGAGAGCGGGGCATGCCAGGAATGCCAGG

CAAGCACGGAGCCAAG GGGGTTCCTGGGATTGCCGTGGCTGGGATGAAG GGTGAGCCAGGGACGCCAGGAACCAAG GGTGAGAAGGGTGCAGCAGGC

TCCCCTGGCCTCCTGGGGCAGAAG GGAGAAAAAGGTGATGCTGGCAATGCCATCGGAGGAGGCAGGGGGGAGCCTGGCCCCCCGGGGCTCCCTGGGCCC

CCTGGGCCAAAG GGAGAAGCTGGTGTTGATGGCCAGGCTGGGCCCCCAGGACAGCAAGGAGACAAG GGGCAGCCAGGAGCAGCTGGTGAACAGGGACC

CTCTGGCCCCAAG GGTGCCAAGGGTGAACCCGGCAAAGGAGAGATGGTGGATTATAATGGCAGCATCAACGAGGCGCTTCAG GAGATCAGGACGCTGG

CCTTGATG GGGCCTCCTGGTCTTCCTGGACAAACAGGCCCACCCGGACCTCCAGGGACTCCAGGCCAAAGG GGGGAGATTGGACTGCCAGGCCCTCCA

GGACACGATGGGGACAAG GGGCCTCGAGGAAAACCAGGAGATATGGGGCCGGCTGGTCCTCAAGGACCCCCAGGAAAGGATGGGCCTCCAGGAATGAAG

GGAGAAGTCGGACCCCCAGGAAGTCCAGGGGAGAAAGGGGAGACAGGACAAGCAGGCCCCCAG GGAGAGAAAGGAGAAGCTGGGGAGAAAGGCGACCCG

GGAGCAGAG GTTCCTGGGCCGCCAGGGCCAGAGGGTCCTCCAGGACCTCCG GGCCTCCAAGGTTTTCCTGGACCAAAG GGAGAAGCAGGCCTAGAGG

GCAGTAAAGGAGAGAAGGGCTCCCAGGGAGAAAAAGGAGACCGGGGGCCTCTGGGATTGCCT - UNI21464 - GGTACTCCAGGACCAATCGGGGTT

CCAGGCCCAGCCGGACCAAAGGGCGAAAGG - UNI21464 - GGCAGCAAAGGCGACCCAGGGATGACGGGACCAACGGGAGCAGCTGGGCTGCCT G

GTTTACATGGACCACCCGGGGACAAAGGAAACCGG GGGGAGAGGGGGAAGAAGGGCTCTAGAGGGCCTAAAGGGGACAAGGGGGACCAAGGAGCACCTG

GACTAGACGCCCCCTGCCCGCTG GGAGAAGATGGCTTACCAGTCCAAGGCTGCTGGAACAAG TGATGCCTCTAACCTGGGACTGGCCTGTGTGTGTTT

GTATATAGGATATTTATTTTTATACAGTTTTCACCTTTTGAAAATGCCCAAACTATGATGCATCTTACAGATCATTAAGAAAGAAAGAAGAAAAGCCTGC

AGATTTTGTACAGGAAATAACCCCTTTCCCTTTTTGTTTACAAGACATTTTTGTATAAATCTGTTTCTAATACACTTTCTGTCTGTGCGTCTGCTCCTAA

TGTTGCATGATATTTGTGCACACTTACTAAATATCACAGCTTCATAAATTATTGTGTTCCAGTGCCAAAGGGGGCCCACCAGCACAGAGGTGCTGTGAGC

TTGTGTGTGAATTCACACACACACACAAAAAAAGTGGAGGTCGGTGGTGTTTGCCAGACTACATGTGTCTGACAATATTTTACATTTTAACTGACGGTCA

TTATTATAAGAAAAAAATAATAAAACGTGGCAATTCA
Translation
MVAERTRKAAASGSRGPGELGAPGPGTVALAEQCARLPSPGCCGLLALALCSLALSLLAHFRTAELQARVLRLEAERGEQQMEKAILGRVNQLLDE KWK

FYSRRRREAPKMSPGCNCPPG - UNI19923 - GPP GPTGRPGLP - UNI26109 - GDKGAIGMPGRV - UNI20163 - GAPGDAGMSIVG

PRGPP GQPGTRGFPGFP GPIGLDGRP GHPGPKGEM GLVGPRGQP GPQGQKGEK GQCGEYPHR EYPGGMLAALRSNPIMSLK GEQSQTGIQGP

PGPPGPPGPSGPLGHPGLPGPIGPP GLPGPPGPK GDPGIQGYHGRK GERGMPGMPGKHGAK GVPGIAVAGMK GEPGTPGTK GEKGAAGSPGLLG

QK GEKGDAGNAIGGGRGEPGPPGLPGPPGPK GEAGVDGQAGPPGQQGDK GQPGAAGEQGPSGPK GAKGEPGKGEMVDYNGSINEALQ EIRTLALM

 GPPGLPGQTGPPGPPGTPGQR GEIGLPGPPGHDGDK GPRGKPGDMGPAGPQGPPGKDGPPGMKGEVGPPGSPGEKGETGQAGPQ GEKGEAGEKGDP

GAE VPGPPGPEGPPGPP GLQGFPGPK GEAGLEGSKGEKGSQGEKGDRGPLGLP - UNI21464 - GTPGPIGVPGPAGPKGER - UNI21464 

- GSKGDPGMTGPTGAAGLP GLHGPPGDKGNR GERGKKGSRGPKGDKGDQGAPGLDAPCPL GEDGLPVQGCWNK K
Transcript ENSMUST00000105454
Sequence
GGCTGTGTCAAGTTACAGAGGCGCCAGAATCGGCCCCAGCGCGGCTCACTGCAGCCACGACCCACCTCTGCCCATGGGGCCCTGCATGCGTGCCCCTTCG

CCCGGGGACTGACACCCGTTCTCCCCGGAGACACAAAACACCCAGAAGGACCCCGAGCGTCGCACCAGCCCGAGAACTCTGCAGAAGAGAGAAGGGAAAG

AGTGGGGAGCGGGGCCAGATCCCCGAACTTGGAACATTCTTCGAAATAACTTTTTTCTTACTTTGGCGTACTCCGATCGCGTCTGCTGGTGGCTCTTGGC

TGCTCCCGACTCCGACTGCTCATTTTCGGTCCTCTTTGGCGAGCAAAGGAAAGGGACGTCCTCTAGCCACGTTAACCCCCTTTCCCCTTGCCTCTCAGTT

TGGATCGCGCCTCTTGGATCTCGTTTTTATTTATTCTATTTATTTATTTATTGGCTCTCAAGACGCGAGGGCATGGTGGCGGAGCGCACCCGCAAAGCGG

CAGCCTCTGGCAGCCGCGGCCCTGGGGAGCTGGGCGCTCCGGGGCCCGGGACAGTGGCGCTGGCTGAGCAGTGCGCTAGGCTGCCGAGCCCCGGGTGCTG

CGGACTGCTGGCTCTAGCGCTGTGTTCGCTGGCGCTCAGCCTGCTCGCCCACTTTCGGACCGCGGAGCTGCAGGCCCGGGTGCTGCGCTTGGAAGCAGAG

CGCGGGGAGCAGCAGATGGAGAAAGCTATTTTGGGACGAGTCAACCAACTGCTGGACGAG AAATGGAAGTTCTACTCGCGTAGGCGCCGGGAAGCCCCG

AAGATGTCTCCAGGATGTAACTGCCCACCAG - UNI19923 - GACCTCCT GGTCCCACTGGAAGACCTGGACTCCCA - UNI26109 - GGGGA

CAAGGGTGCCATCGGGATGCCTGGACGTGTG GGTATCAAAGGTCAACCAGGCGAGAAG - UNI20163 - GGTGCCCCTGGAGATGCGGGGATGTCC

ATCGTCGGGCCTCGAGGCCCCCCT GGCCAGCCTGGTACCCGAGGTTTCCCTGGATTCCCG GGTCCCATTGGTCTTGACGGCAGGCCG GGCCACCCCG

GACCTAAAGGGGAGATG GGCCTGGTGGGTCCTCGAGGACAACCG GGACCTCAGGGACAAAAGGGAGAAAAG GGTCAGTGTGGAGAGTACCCACACAG

G GAGTACCCAGGCGGCATGCTAGCAGCTCTGCGCTCCAACCCGATAATGTCCCTAAAG CTGTTGCCTCTACTCAATTCAGTGCGGCTGGCTCCACCCC

CAGTCATTAAAAGGCGGACCTTTCAG GGGGAACAAAGTCAGACTGGCATCCAAGGCCCTCCAGGGCCACCGGGCCCCCCAGGACCAAGTGGCCCTCTGG

GACACCCAGGACTGCCAGGGCCTATAGGGCCACCT GGTTTACCGGGGCCTCCTGGACCAAAG GGAGACCCAGGGATCCAGGGCTATCATGGCCGCAAG

 GGAGAGCGGGGCATGCCAGGAATGCCAGGCAAGCACGGAGCCAAG GGGGTTCCTGGGATTGCCGTGGCTGGGATGAAG GGTGAGCCAGGGACGCCAG

GAACCAAG GGTGAGAAGGGTGCAGCAGGCTCCCCTGGCCTCCTGGGGCAGAAG GGAGAAAAAGGTGATGCTGGCAATGCCATCGGAGGAGGCAGGGGG

GAGCCTGGCCCCCCGGGGCTCCCTGGGCCCCCTGGGCCAAAG GGAGAAGCTGGTGTTGATGGCCAGGCTGGGCCCCCAGGACAGCAAGGAGACAAG GG

GCAGCCAGGAGCAGCTGGTGAACAGGGACCCTCTGGCCCCAAG GGTGCCAAGGGTGAACCCGGCAAAGGAGAGATGGTGGATTATAATGGCAGCATCAA

CGAGGCGCTTCAG GAGATCAGGACGCTGGCCTTGATG GGGCCTCCTGGTCTTCCTGGACAAACAGGCCCACCCGGACCTCCAGGGACTCCAGGCCAAA

GG GGGGAGATTGGACTGCCAGGCCCTCCAGGACACGATGGGGACAAG GGGCCTCGAGGAAAACCAGGAGATATGGGGCCGGCTGGTCCTCAAGGACCC

CCAGGAAAGGATGGGCCTCCAGGAATGAAGGGAGAAGTCGGACCCCCAGGAAGTCCAGGGGAGAAAGGGGAGACAGGACAAGCAGGCCCCCAG GGTCTA

GACGGCCCAACTGGGGAGAAAGGAGAACCAGGTGACGAAGGGAGGCCTGGAGCGACAGGATTGCCTGGGCCCATCGGGCTCCCGGGATTCACA GGAGAG

AAAGGAGAAGCTGGGGAGAAAGGCGACCCGGGAGCAGAG GTTCCTGGGCCGCCAGGGCCAGAGGGTCCTCCAGGACCTCCG GGCCTCCAAGGTTTTCC

TGGACCAAAG GGAGAAGCAGGCCTAGAGGGCAGTAAAGGAGAGAAGGGCTCCCAGGGAGAAAAAGGAGACCGGGGGCCTCTGGGATTGCCT - UNI21

464 - GGTACTCCAGGACCAATCGGGGTTCCAGGCCCAGCCGGACCAAAGGGCGAAAGG - UNI21464 - GGCAGCAAAGGCGACCCAGGGATGAC

GGGACCAACGGGAGCAGCTGGGCTGCCT GGTTTACATGGACCACCCGGGGACAAAGGAAACCGG GGGGAGAGGGGGAAGAAGGGCTCTAGAGGGCCTA

AAGGGGACAAGGGGGACCAAGGAGCACCTGGACTAGACGCCCCCTGCCCGCTG GGAGAAGATGGCTTACCAGTCCAAGGCTGCTGGAACAAG TGATGC

CTCTAACCTGGGACTGGCCTGTGTGTGTTTGTATATAGGATATTTATTTTTATACAGTTTTCACCTTTTGAAAATGCCCAAACTATGATGCATCTTACAG

ATCATTAAGAAAGAAAGAAGAAAAGCCTGCAGATTTTGTACAGGAAATAACCCCTTTCCCTTTTTGTTTACAAGACATTTTTGTATAAATCTGTTTCTAA

TACAC
Translation
MVAERTRKAAASGSRGPGELGAPGPGTVALAEQCARLPSPGCCGLLALALCSLALSLLAHFRTAELQARVLRLEAERGEQQMEKAILGRVNQLLDE KWK

FYSRRRREAPKMSPGCNCPPG - UNI19923 - GPP GPTGRPGLP - UNI26109 - GDKGAIGMPGRV GIKGQPGEK - UNI20163 - GA

PGDAGMSIVGPRGPP GQPGTRGFPGFP GPIGLDGRP GHPGPKGEM GLVGPRGQP GPQGQKGEK GQCGEYPHR EYPGGMLAALRSNPIMSLK L

LPLLNSVRLAPPPVIKRRTFQ GEQSQTGIQGPPGPPGPPGPSGPLGHPGLPGPIGPP GLPGPPGPK GDPGIQGYHGRK GERGMPGMPGKHGAK GV

PGIAVAGMK GEPGTPGTK GEKGAAGSPGLLGQK GEKGDAGNAIGGGRGEPGPPGLPGPPGPK GEAGVDGQAGPPGQQGDK GQPGAAGEQGPSGPK

 GAKGEPGKGEMVDYNGSINEALQ EIRTLALM GPPGLPGQTGPPGPPGTPGQR GEIGLPGPPGHDGDK GPRGKPGDMGPAGPQGPPGKDGPPGMKG

EVGPPGSPGEKGETGQAGPQ GLDGPTGEKGEPGDEGRPGATGLPGPIGLPGFT GEKGEAGEKGDPGAE VPGPPGPEGPPGPP GLQGFPGPK GEAG

LEGSKGEKGSQGEKGDRGPLGLP - UNI21464 - GTPGPIGVPGPAGPKGER - UNI21464 - GSKGDPGMTGPTGAAGLP GLHGPPGDKGNR

 GERGKKGSRGPKGDKGDQGAPGLDAPCPL GEDGLPVQGCWNK K
Transcript ENSMUST00000105452
Sequence
CCAGCGCGGCTCACTGCAGCCACGACCCACCTCTGCCCATGGGGCCCTGCATGCGTGCCCCTTCGCCCGGGGACTGACACCCGTTCTCCCCGGAGACACA

AAACACCCAGAAGGACCCCGAGCGTCGCACCAGCCCGAGAACTCTGCAGAAGAGAGAAGGGAAAGAGTGGGGAGCGGGGCCAGATCCCCGAACTTGGAAC

ATTCTTCGAAATAACTTTTTTCTTACTTTGGCGTACTCCGATCGCGTCTGCTGGTGGCTCTTGGCTGCTCCCGACTCCGACTGCTCATTTTCGGTCCTCT

TTGGCGAGCAAAGGAAAGGGACGTCCTCTAGCCACGTTAACCCCCTTTCCCCTTGCCTCTCAGTTTGGATCGCGCCTCTTGGATCTCGTTTTTATTTATT

CTATTTATTTATTTATTGGCTCTCAAGACGCGAGGGCATGGTGGCGGAGCGCACCCGCAAAGCGGCAGCCTCTGGCAGCCGCGGCCCTGGGGAGCTGGGC

GCTCCGGGGCCCGGGACAGTGGCGCTGGCTGAGCAGTGCGCTAGGCTGCCGAGCCCCGGGTGCTGCGGACTGCTGGCTCTAGCGCTGTGTTCGCTGGCGC

TCAGCCTGCTCGCCCACTTTCGGACCGCGGAGCTGCAGGCCCGGGTGCTGCGCTTGGAAGCAGAGCGCGGGGAGCAGCAGATGGAGAAAGCTATTTTGGG

ACGAGTCAACCAACTGCTGGACGAG AAATGGAAGTTCTACTCGCGTAGGCGCCGGGAAGCCCCGAAGATGTCTCCAGGATGTAACTGCCCACCAG - U

NI19923 - GACCTCCT GGTCCCACTGGAAGACCTGGACTCCCA - UNI26109 - GGGGACAAGGGTGCCATCGGGATGCCTGGACGTGTG GGT

ATCAAAGGTCAACCAGGCGAGAAG - UNI20163 - GGTGCCCCTGGAGATGCGGGGATGTCCATCGTCGGGCCTCGAGGCCCCCCT GGCCAGCCTG

GTACCCGAGGTTTCCCTGGATTCCCG GGTCCCATTGGTCTTGACGGCAGGCCG GGCCACCCCGGACCTAAAGGGGAGATG GGCCTGGTGGGTCCTCG

AGGACAACCG GGACCTCAGGGACAAAAGGGAGAAAAG GGTCAGTGTGGAGAGTACCCACACAGG GAGTACCCAGGCGGCATGCTAGCAGCTCTGCGC

TCCAACCCGATAATGTCCCTAAAG CTGTTGCCTCTACTCAATTCAGTGCGGCTGGCTCCACCCCCAGTCATTAAAAGGCGGACCTTTCAG GGGGAACA

AAGTCAGACTGGCATCCAAGGCCCTCCAGGGCCACCGGGCCCCCCAGGACCAAGTGGCCCTCTGGGACACCCAGGACTGCCAGGGCCTATAGGGCCACCT

 GGTTTACCGGGGCCTCCTGGACCAAAG GGAGACCCAGGGATCCAGGGCTATCATGGCCGCAAG GGAGAGCGGGGCATGCCAGGAATGCCAGGCAAGC

ACGGAGCCAAG GGGGTTCCTGGGATTGCCGTGGCTGGGATGAAG GGTGAGCCAGGGACGCCAGGAACCAAG GGTGAGAAGGGTGCAGCAGGCTCCCC

TGGCCTCCTGGGGCAGAAG GGAGAAAAAGGTGATGCTGGCAATGCCATCGGAGGAGGCAGGGGGGAGCCTGGCCCCCCGGGGCTCCCTGGGCCCCCTGG

GCCAAAG GGAGAAGCTGGTGTTGATGGCCAGGCTGGGCCCCCAGGACAGCAAGGAGACAAG GGGCAGCCAGGAGCAGCTGGTGAACAGGGACCCTCTG

GCCCCAAG GGTGCCAAGGGTGAACCCGGCAAAGGAGAGATGGTGGATTATAATGGCAGCATCAACGAGGCGCTTCAG GAGATCAGGACGCTGGCCTTG

ATG GGGCCTCCTGGTCTTCCTGGACAAACAGGCCCACCCGGACCTCCAGGGACTCCAGGCCAAAGG GGGGAGATTGGACTGCCAGGCCCTCCAGGACA

CGATGGGGACAAG GGGCCTCGAGGAAAACCAGGAGATATGGGGCCGGCTGGTCCTCAAGGACCCCCAGGAAAGGATGGGCCTCCAGGAATGAAGGGAGA

AGTCGGACCCCCAGGAAGTCCAGGGGAGAAAGGGGAGACAGGACAAGCAGGCCCCCAG GGAGAGAAAGGAGAAGCTGGGGAGAAAGGCGACCCGGGAGC

AGAG GTTCCTGGGCCGCCAGGGCCAGAGGGTCCTCCAGGACCTCCG GGCCTCCAAGGTTTTCCTGGACCAAAG GGAGAAGCAGGCCTAGAGGGCAGT

AAAGGAGAGAAGGGCTCCCAGGGAGAAAAAGGAGACCGGGGGCCTCTGGGATTGCCT GGAGCTTCAGGTTTGGACGGCAGGCCTGGGCCACCG - UNI

21464 - GGTACTCCAGGACCAATCGGGGTTCCAGGCCCAGCCGGACCAAAGGGCGAAAGG - UNI21464 - GGCAGCAAAGGCGACCCAGGGATG

ACGGGACCAACGGGAGCAGCTGGGCTGCCT GGTTTACATGGACCACCCGGGGACAAAGGAAACCGG GGGGAGAGGGGGAAGAAGGGCTCTAGAGGGCC

TAAAGGGGACAAGGGGGACCAAGGAGCACCTGGACTAGACGCCCCCTGCCCGCTG GGAGAAGATGGCTTACCAGTCCAAGGCTGCTGGAACAAG TGAT

GCCTCTAACCTGGGACTGGCCTGTGTGTGTTTGTATATAGGATATTTATTTTTATACAGTTTTCACCTTTTGAAAATGCCCAAACTATGATGCATCTTAC

AGATCATTAAGAAAGAAAGAAGAAAAGCCTGCAGATTTTGTACAGGAAATAACCCCTTTCCCTTTTTGTTTACAAGACATTTTTGTATAAATCTGTTTCT

AATACACTTTCTGTCTGTGCGTCTGCTCCTAATGTTGCATGATATTTGTGCACACTTACTAAATATCACAGCTTCATAAATTATTGTGTTCCAGTGCCAA

AGGGGGCCCACCAGCACAGAGGTGCTGTGAGCTTGTGTGTGAATTCACACACACACACAAAAAAAGTGGAGGTCGGTGGTGTTTGCCAGACTACATGTGT

CTGACAATATTTTACATTTTAACTGACGGTCATTATTATAAGAAAAAAATAATAAAACGTGGCAATTCA
Translation
MVAERTRKAAASGSRGPGELGAPGPGTVALAEQCARLPSPGCCGLLALALCSLALSLLAHFRTAELQARVLRLEAERGEQQMEKAILGRVNQLLDE KWK

FYSRRRREAPKMSPGCNCPPG - UNI19923 - GPP GPTGRPGLP - UNI26109 - GDKGAIGMPGRV GIKGQPGEK - UNI20163 - GA

PGDAGMSIVGPRGPP GQPGTRGFPGFP GPIGLDGRP GHPGPKGEM GLVGPRGQP GPQGQKGEK GQCGEYPHR EYPGGMLAALRSNPIMSLK L

LPLLNSVRLAPPPVIKRRTFQ GEQSQTGIQGPPGPPGPPGPSGPLGHPGLPGPIGPP GLPGPPGPK GDPGIQGYHGRK GERGMPGMPGKHGAK GV

PGIAVAGMK GEPGTPGTK GEKGAAGSPGLLGQK GEKGDAGNAIGGGRGEPGPPGLPGPPGPK GEAGVDGQAGPPGQQGDK GQPGAAGEQGPSGPK

 GAKGEPGKGEMVDYNGSINEALQ EIRTLALM GPPGLPGQTGPPGPPGTPGQR GEIGLPGPPGHDGDK GPRGKPGDMGPAGPQGPPGKDGPPGMKG

EVGPPGSPGEKGETGQAGPQ GEKGEAGEKGDPGAE VPGPPGPEGPPGPP GLQGFPGPK GEAGLEGSKGEKGSQGEKGDRGPLGLP GASGLDGRPG

PP - UNI21464 - GTPGPIGVPGPAGPKGER - UNI21464 - GSKGDPGMTGPTGAAGLP GLHGPPGDKGNR GERGKKGSRGPKGDKGDQGA

PGLDAPCPL GEDGLPVQGCWNK K
Transcript ENSMUST00000092484
Sequence
GGCTGTGTCAAGTTACAGAGGCGCCAGAATCGGCCCCAGCGCGGCTCACTGCAGCCACGACCCACCTCTGCCCATGGGGCCCTGCATGCGTGCCCCTTCG

CCCGGGGACTGACACCCGTTCTCCCCGGAGACACAAAACACCCAGAAGGACCCCGAGCGTCGCACCAGCCCGAGAACTCTGCAGAAGAGAGAAGGGAAAG

AGTGGGGAGCGGGGCCAGATCCCCGAACTTGGAACATTCTTCGAAATAACTTTTTTCTTACTTTGGCGTACTCCGATCGCGTCTGCTGGTGGCTCTTGGC

TGCTCCCGACTCCGACTGCTCATTTTCGGTCCTCTTTGGCGAGCAAAGGAAAGGGACGTCCTCTAGCCACGTTAACCCCCTTTCCCCTTGCCTCTCAGTT

TGGATCGCGCCTCTTGGATCTCGTTTTTATTTATTCTATTTATTTATTTATTGGCTCTCAAGACGCGAGGGCATGGTGGCGGAGCGCACCCGCAAAGCGG

CAGCCTCTGGCAGCCGCGGCCCTGGGGAGCTGGGCGCTCCGGGGCCCGGGACAGTGGCGCTGGCTGAGCAGTGCGCTAGGCTGCCGAGCCCCGGGTGCTG

CGGACTGCTGGCTCTAGCGCTGTGTTCGCTGGCGCTCAGCCTGCTCGCCCACTTTCGGACCGCGGAGCTGCAGGCCCGGGTGCTGCGCTTGGAAGCAGAG

CGCGGGGAGCAGCAGATGGAGAAAGCTATTTTGGGACGAGTCAACCAACTGCTGGACGAG AAATGGAAGTTCTACTCGCGTAGGCGCCGGGAAGCCCCG

AAGATGTCTCCAGGATGTAACTGCCCACCAG - UNI19923 - GACCTCCT GGTCCCACTGGAAGACCTGGACTCCCA - UNI26109 - GGGGA

CAAGGGTGCCATCGGGATGCCTGGACGTGTG GGTATCAAAGGTCAACCAGGCGAGAAG - UNI20163 - GGTGCCCCTGGAGATGCGGGGATGTCC

ATCGTCGGGCCTCGAGGCCCCCCT GGCCAGCCTGGTACCCGAGGTTTCCCTGGATTCCCG GGTCCCATTGGTCTTGACGGCAGGCCG GGCCACCCCG

GACCTAAAGGGGAGATG GGCCTGGTGGGTCCTCGAGGACAACCG GGACCTCAGGGACAAAAGGGAGAAAAG GGTCAGTGTGGAGAGTACCCACACAG

G GAGTACCCAGGCGGCATGCTAGCAGCTCTGCGCTCCAACCCGATAATGTCCCTAAAG CTGTTGCCTCTACTCAATTCAGTGCGGCTGGCTCCACCCC

CAGTCATTAAAAGGCGGACCTTTCAG GGGGAACAAAGTCAGACTGGCATCCAAGGCCCTCCAGGGCCACCGGGCCCCCCAGGACCAAGTGGCCCTCTGG

GACACCCAGGACTGCCAGGGCCTATAGGGCCACCT GGTTTACCGGGGCCTCCTGGACCAAAG GGAGACCCAGGGATCCAGGGCTATCATGGCCGCAAG

 GGAGAGCGGGGCATGCCAGGAATGCCAGGCAAGCACGGAGCCAAG GGGGTTCCTGGGATTGCCGTGGCTGGGATGAAG GGTGAGCCAGGGACGCCAG

GAACCAAG GGTGAGAAGGGTGCAGCAGGCTCCCCTGGCCTCCTGGGGCAGAAG GGAGAAAAAGGTGATGCTGGCAATGCCATCGGAGGAGGCAGGGGG

GAGCCTGGCCCCCCGGGGCTCCCTGGGCCCCCTGGGCCAAAG GGAGAAGCTGGTGTTGATGGCCAGGCTGGGCCCCCAGGACAGCAAGGAGACAAG GG

GCAGCCAGGAGCAGCTGGTGAACAGGGACCCTCTGGCCCCAAG GGTGCCAAGGGTGAACCCGGCAAAGGAGAGATGGTGGATTATAATGGCAGCATCAA

CGAGGCGCTTCAG GAGATCAGGACGCTGGCCTTGATG GGGCCTCCTGGTCTTCCTGGACAAACAGGCCCACCCGGACCTCCAGGGACTCCAGGCCAAA

GG GGGGAGATTGGACTGCCAGGCCCTCCAGGACACGATGGGGACAAG GGGCCTCGAGGAAAACCAGGAGATATGGGGCCGGCTGGTCCTCAAGGACCC

CCAGGAAAGGATGGGCCTCCAGGAATGAAGGGAGAAGTCGGACCCCCAGGAAGTCCAGGGGAGAAAGGGGAGACAGGACAAGCAGGCCCCCAG GGTCTA

GACGGCCCAACTGGGGAGAAAGGAGAACCAGGTGACGAAGGGAGGCCTGGAGCGACAGGATTGCCTGGGCCCATCGGGCTCCCGGGATTCACA GGAGAG

AAAGGAGAAGCTGGGGAGAAAGGCGACCCGGGAGCAGAG GTTCCTGGGCCGCCAGGGCCAGAGGGTCCTCCAGGACCTCCG GGCCTCCAAGGTTTTCC

TGGACCAAAG GGAGAAGCAGGCCTAGAGGGCAGTAAAGGAGAGAAGGGCTCCCAGGGAGAAAAAGGAGACCGGGGGCCTCTGGGATTGCCT GGAGCTT

CAGGTTTGGACGGCAGGCCTGGGCCACCG - UNI21464 - GGTACTCCAGGACCAATCGGGGTTCCAGGCCCAGCCGGACCAAAGGGCGAAAGG - 

UNI21464 - GGCAGCAAAGGCGACCCAGGGATGACGGGACCAACGGGAGCAGCTGGGCTGCCT GGTTTACATGGACCACCCGGGGACAAAGGAAACC

GG GGGGAGAGGGGGAAGAAGGGCTCTAGAGGGCCTAAAGGGGACAAGGGGGACCAAGGAGCACCTGGACTAGACGCCCCCTGCCCGCTG GGAGAAGAT

GGCTTACCAGTCCAAGGCTGCTGGAACAAG TGATGCCTCTAACCTGGGACTGGCCTGTGTGTGTTTGTATATAGGATATTTATTTTTATACAGTTTTCA

CCTTTTGAAAATGCCCAAACTATGATGCATCTTACAGATCATTAAGAAAGAAAGAAGAAAAGCCTGCAGATTTTGTACAGGAAATAACCCCTTTCCCTTT

TTGTTTACAAGACATTTTTGTATAAATCTGTTTCTAATACAC
Translation
MVAERTRKAAASGSRGPGELGAPGPGTVALAEQCARLPSPGCCGLLALALCSLALSLLAHFRTAELQARVLRLEAERGEQQMEKAILGRVNQLLDE KWK

FYSRRRREAPKMSPGCNCPPG - UNI19923 - GPP GPTGRPGLP - UNI26109 - GDKGAIGMPGRV GIKGQPGEK - UNI20163 - GA

PGDAGMSIVGPRGPP GQPGTRGFPGFP GPIGLDGRP GHPGPKGEM GLVGPRGQP GPQGQKGEK GQCGEYPHR EYPGGMLAALRSNPIMSLK L

LPLLNSVRLAPPPVIKRRTFQ GEQSQTGIQGPPGPPGPPGPSGPLGHPGLPGPIGPP GLPGPPGPK GDPGIQGYHGRK GERGMPGMPGKHGAK GV

PGIAVAGMK GEPGTPGTK GEKGAAGSPGLLGQK GEKGDAGNAIGGGRGEPGPPGLPGPPGPK GEAGVDGQAGPPGQQGDK GQPGAAGEQGPSGPK

 GAKGEPGKGEMVDYNGSINEALQ EIRTLALM GPPGLPGQTGPPGPPGTPGQR GEIGLPGPPGHDGDK GPRGKPGDMGPAGPQGPPGKDGPPGMKG

EVGPPGSPGEKGETGQAGPQ GLDGPTGEKGEPGDEGRPGATGLPGPIGLPGFT GEKGEAGEKGDPGAE VPGPPGPEGPPGPP GLQGFPGPK GEAG

LEGSKGEKGSQGEKGDRGPLGLP GASGLDGRPGPP - UNI21464 - GTPGPIGVPGPAGPKGER - UNI21464 - GSKGDPGMTGPTGAAGLP

 GLHGPPGDKGNR GERGKKGSRGPKGDKGDQGAPGLDAPCPL GEDGLPVQGCWNK K

For any suggestions or comments, please send an email to unitrap@crg.es