Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000058883 (Zfp708)
Chromosomal location
Chr 13: 67170336 - 67198770 (-)
Description
zinc finger protein 708 Gene [Source:MGI Symbol;Acc:MGI:3040674]
RefSeq_dna
NM_001012449 NM_001012325 
RefSeq_peptide
NP_001012450.2 NP_001012451.2 NP_001012325.2 
UniGene
Mm.458849 
MGI
MGI:3040674 
Uniprot/SPTREMBL
Q7M6X4 
Human Ortholog
not available
Omim not available
UniTrap UNI33297
Vector Insertion
Chr 13: 67182385 - 67198771
Public Clones IST13191H6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000109742
Sequence
CCAAACTCTGCGGCTTTCTCAAAGTTGGAACAGTGTGGCTTGCGCTCCGCGCTCGACATGGAG - UNI33297 - GACCCTCTGTCATTTACAGATGT

GGCCATTGATTTCTCTGCAGATGAGTGTGAATGTCTGGACTCTGCTCAGTGGAATTTGTATAAGGAAGTGATGTTGGAGAATTACAGCAACCTTGTGTTC

CTGG GTCTTGCTTTCTCTAAGCCATACCTGGTCACATTTCTGGAGCAGAGTTCAGATCTGTGGAGTGTGAAGAGGAAGGCATCAGTGGCCATCCATCTA

G GATCAAAAGCCCATAAATGTAAAGAATGTGGGAAATCCTTTGATAGGAACTCAGTCCTTATTCAACATCAAAGAATTCATACTGGAGAGAGGCCCTAC

AAATGTGAAGAATGTGGCATGGCCTTCACCGGTCGCTGCATTCTTTCTAAGCACCAGCGAATCCATACTGGAGAAAAACCCTACAAATGTAAAGAATGTG

GCAAAGCTTTCAGCTGTTCTTCTAACCTTCACCAACACCAACAAATTCATAGGGAAGAGAAACCCTATAAATGCGATGACTGTGGGAAGGCCTTTAGCTG

TTCTTCATATCTGTATAAGCATCAGCGAATCCATACTGGCATGAAACCCTACAAATGCAAGGAATGTGGCAAGGCCTTTAACTGTTCTGCAAACCTTATT

TACCACCAGAGAATTCATACTGGAGAGAAACCATATAAGTGTGGTGAATGTGGGAAAGCCTTTACCATTTATTCAACATTTATGAATCACCAGCGAACAC

ATAGTGGAGAAAAACCGTATGAATGCAAAGACTGTGGGAAAGCCTTTACTAATTGTTATAATCTAATTCAACACCAAAGAATTCATACTGGAGAGAAACC

CTATGCATGTGAAGAATGTGGCAAATCTTTTAACTATTCTTCCCATCTTAAACAACACAAAAGAATCCATACTGGAGAGAAACCATATAAATGTGAAGTG

TGTGGCAAAGCTTTTAACTGTTCCGATTATCTTGTTAAGCATCAAAGAATTCATACTGGAGAGAAACCCTACAAATGTGAAGTATGTGGCAAAGCTTTTA

GCTTTTCTACATATCTGCATAAACATCAAAGAATCCACACTGGAGAGAAACGCTACAGATGTGAAGAATGTGGTAAAGCTTTTACTAATTATTCAGGGCT

TATTGTTCACCGAAGAGTACATACTGGAGAGAAACCCTACAAATGTGAAGAATGTGGCAAGGCCTTTAGTGTTCACACATCACTCTCTAAACATCAGAGA

ATTCATACGAGAGAGCAACCTTACAAATGTGATGAATGTGGAAAGACCTTTAGTGTTCACTCAACATTCTCTAAACATCAGATAATGCATACTAGAGAGA

AACCCTACAAATGCAAACACTGCGACAAGACCTTCAAATATCCTTCACCCCTTGTTCAACATGAAAGAATTCACACTGGAGAGAGACCCTACAAATGTGA

AGTTTGTGGCAAGGCCTTTACTTCTTCTTCAAATCTTAAATATCATTGGAGACTTCATACTGGCGAGAAGCCCTATAAATGTGAACAATGTGGTAAAGCC

TTTAAAAATAGTTCAAATGTCACTCGACACTACAAAATTCATACTAGAGAAAATCCAGATTAATGCAAACACTTTTGTAAAGCCTTCCACAGTTGTTCAT

TGACAATTCAGCACTAAAGAATTCATATAAAAGAAAAACCTTAGAAATGAAAGAAATAAGGAAAAACCTTTAATAATAGTTCAACCCATATTCAACATCC

ACCATTACATACTGGAGAGATCTTGTAATAGTGAAGAAGATGGCCGTGTTGAGCGTTCAATACTTATGGAGCATCAAATTTTTTAGAGAAACACTACAAA

TGCAGGTAATACAGGAACTGCTCATTAACCATGAGTGATTTATAACCAGATGTTATACATGCAAAATGACTTTGGAAGGAACACTGACAAATACATAAAA

CTGAGAAAACCAAACTGGTTCAGTAAAAAGCACTTTGTAAACAGTGTTGCAACACTTTGCTCATCATGTAAATCTTGAGAGATTGGAGAGAATTATCTAT

CATAAGAGACAAATTCCAGGAGCTGTATAGGATTTAGCAAGCCACCAAGTGCTGCTCTGAATTCCTAAAGAATTAATACAGAACTCTGAACTCACTAAGA

AATGTTTGGTGTGCTATAAAAACTCATTATAGACTTTGGAATCATGCAGATAAGTTTGTGAGGACATCAATGTGTTATAAATTGAAATTATAAGCTCAAT

TTTAAAAAGTGATAAGATCACTCAACTAGTGATTTTTATCAGTTTGTTTTTTTCCCCCCAAAGACCATAGATACATTATTGGAATATGAAGTTTAGTAAC

TTCTGTAAATAAAAATAAACTGTTTTAATGT
Translation
ME - UNI33297 - DPLSFTDVAIDFSADECECLDSAQWNLYKEVMLENYSNLVFLG GLAFSKPYLVTFLEQSSDLWSVKRKASVAIHLG GSKAHK

CKECGKSFDRNSVLIQHQRIHTGERPYKCEECGMAFTGRCILSKHQRIHTGEKPYKCKECGKAFSCSSNLHQHQQIHREEKPYKCDDCGKAFSCSSYLYK

HQRIHTGMKPYKCKECGKAFNCSANLIYHQRIHTGEKPYKCGECGKAFTIYSTFMNHQRTHSGEKPYECKDCGKAFTNCYNLIQHQRIHTGEKPYACEEC

GKSFNYSSHLKQHKRIHTGEKPYKCEVCGKAFNCSDYLVKHQRIHTGEKPYKCEVCGKAFSFSTYLHKHQRIHTGEKRYRCEECGKAFTNYSGLIVHRRV

HTGEKPYKCEECGKAFSVHTSLSKHQRIHTREQPYKCDECGKTFSVHSTFSKHQIMHTREKPYKCKHCDKTFKYPSPLVQHERIHTGERPYKCEVCGKAF

TSSSNLKYHWRLHTGEKPYKCEQCGKAFKNSSNVTRHYKIHTRENPD
Transcript ENSMUST00000091527
Sequence
ATGATAATTGAAGTCTTCATCAACGCCAAAGAAATGACCAAG - UNI33297 - GACCCTCTGTCATTTACAGATGTGGCCATTGATTTCTCTGCAGA

TGAGTGTGAATGTCTGGACTCTGCTCAGTGGAATTTGTATAAGGAAGTGATGTTGGAGAATTACAGCAACCTTGTGTTCCTGG GATCAAAAGCCCATAA

ATGTAAAGAATGTGGGAAATCCTTTGATAGGAACTCAGTCCTTATTCAACATCAAAGAATTCATACTGGAGAGAGGCCCTACAAATGTGAAGAATGTGGC

ATGGCCTTCACCGGTCGCTGCATTCTTTCTAAGCACCAGCGAATCCATACTGGAGAAAAACCCTACAAATGTAAAGAATGTGGCAAAGCTTTCAGCTGTT

CTTCTAACCTTCACCAACACCAACAAATTCATAGGGAAGAGAAACCCTATAAATGCGATGACTGTGGGAAGGCCTTTAGCTGTTCTTCATATCTGTATAA

GCATCAGCGAATCCATACTGGCATGAAACCCTACAAATGCAAGGAATGTGGCAAGGCCTTTAACTGTTCTGCAAACCTTATTTACCACCAGAGAATTCAT

ACTGGAGAGAAACCATATAAGTGTGGTGAATGTGGGAAAGCCTTTACCATTTATTCAACATTTATGAATCACCAGCGAACACATAGTGGAGAAAAACCGT

ATGAATGCAAAGACTGTGGGAAAGCCTTTACTAATTGTTATAATCTAATTCAACACCAAAGAATTCATACTGGAGAGAAACCCTATGCATGTGAAGAATG

TGGCAAATCTTTTAACTATTCTTCCCATCTTAAACAACACAAAAGAATCCATACTGGAGAGAAACCATATAAATGTGAAGTGTGTGGCAAAGCTTTTAAC

TGTTCCGATTATCTTGTTAAGCATCAAAGAATTCATACTGGAGAGAAACCCTACAAATGTGAAGTATGTGGCAAAGCTTTTAGCTTTTCTACATATCTGC

ATAAACATCAAAGAATCCACACTGGAGAGAAACGCTACAGATGTGAAGAATGTGGTAAAGCTTTTACTAATTATTCAGGGCTTATTGTTCACCGAAGAGT

ACATACTGGAGAGAAACCCTACAAATGTGAAGAATGTGGCAAGGCCTTTAGTGTTCACACATCACTCTCTAAACATCAGAGAATTCATACGAGAGAGCAA

CCTTACAAATGTGATGAATGTGGAAAGACCTTTAGTGTTCACTCAACATTCTCTAAACATCAGATAATGCATACTAGAGAGAAACCCTACAAATGCAAAC

ACTGCGACAAGACCTTCAAATATCCTTCACCCCTTGTTCAACATGAAAGAATTCACACTGGAGAGAGACCCTACAAATGTGAAGTTTGTGGCAAGGCCTT

TACTTCTTCTTCAAATCTTAAATATCATTGGAGACTTCATACTGGCGAGAAGCCCTATAAATGTGAACAATGTGGTAAAGCCTTTAAAAATAGTTCAAAT

GTCACTCGACACTACAAAATTCATACTAGAGAAAATCCAGATTAATGCAAACACTTTTGTAAAGCCTTCCACAGTTGTTCATTGACAATTCAGCACTAAA

GAATTCATATAAAAGAAAAACCTTAGAAATGAAAGAAATAAGGAAAAACCTTTAATAATAGTTCAACCCATATTCAACATCCACCATTACATACTGGAGA

GATCTTGTAATAGTGAAGAAGATGGCCGTGTTGAGCGTTCAATACTTATGGAGCATCAAATTTTTTAGAGAAACACTACAAATGCAGGTAATACAGGAAC

TGCTCATTAACCATGAGTGATTTATAACCAGATGTTATACATGCAAAATGACTTTGGAAGGAACACTGACAAATACATAAAACTGAGAAAACCAAACTGG

TTCAGTAAAAAGCACTTTGTAAACAGTGTTGCAACACTTTGCTCATCATGTAAATCTTGAGAGATTGGAGAGAATTATCTATCATAAGAGACAAATTCCA

GGAGCTGTATAGGATTTAGCAAGCCACCAAGTGCTGCTCTGAATTCCTAAAGAATTAATACAGAACTCTGAACTCACTAAGAAATGTTTGGTGTGCTATA

AAAACTCATTATAGACTTTGGAATCATGCAGATAAGTTTGTGAGGACATCAATGTGTTATAAATTGAAATTATAAGCTCAATTTTAAAAAGTGATAAGAT

CACTCAACTAGTGATTTTTATCAGTTTGTTTTTTTCCCCCCAAAGACCATAGATACATTATTGGAATATGAAGTTTAGTAACTTCTGTAAATAAAAATAA

ACTGTTTTAATGT
Translation
MIIEVFINAKEMTK - UNI33297 - DPLSFTDVAIDFSADECECLDSAQWNLYKEVMLENYSNLVFLG GSKAHKCKECGKSFDRNSVLIQHQRIHT

GERPYKCEECGMAFTGRCILSKHQRIHTGEKPYKCKECGKAFSCSSNLHQHQQIHREEKPYKCDDCGKAFSCSSYLYKHQRIHTGMKPYKCKECGKAFNC

SANLIYHQRIHTGEKPYKCGECGKAFTIYSTFMNHQRTHSGEKPYECKDCGKAFTNCYNLIQHQRIHTGEKPYACEECGKSFNYSSHLKQHKRIHTGEKP

YKCEVCGKAFNCSDYLVKHQRIHTGEKPYKCEVCGKAFSFSTYLHKHQRIHTGEKRYRCEECGKAFTNYSGLIVHRRVHTGEKPYKCEECGKAFSVHTSL

SKHQRIHTREQPYKCDECGKTFSVHSTFSKHQIMHTREKPYKCKHCDKTFKYPSPLVQHERIHTGERPYKCEVCGKAFTSSSNLKYHWRLHTGEKPYKCE

QCGKAFKNSSNVTRHYKIHTRENPD
Transcript ENSMUST00000109743
Sequence
ATGATAATTGAAGTCTTCATCAACGCCAAAGAAATGACCAAG - UNI33297 - GACCCTCTGTCATTTACAGATGTGGCCATTGATTTCTCTGCAGA

TGAGTGTGAATGTCTGGACTCTGCTCAGTGGAATTTGTATAAGGAAGTGATGTTGGAGAATTACAGCAACCTTGTGTTCCTGG GTCTTGCTTTCTCTAA

GCCATACCTGGTCACATTTCTGGAGCAGAGTTCAGATCTGTGGAGTGTGAAGAGGAAGGCATCAGTGGCCATCCATCTAG GATCAAAAGCCCATAAATG

TAAAGAATGTGGGAAATCCTTTGATAGGAACTCAGTCCTTATTCAACATCAAAGAATTCATACTGGAGAGAGGCCCTACAAATGTGAAGAATGTGGCATG

GCCTTCACCGGTCGCTGCATTCTTTCTAAGCACCAGCGAATCCATACTGGAGAAAAACCCTACAAATGTAAAGAATGTGGCAAAGCTTTCAGCTGTTCTT

CTAACCTTCACCAACACCAACAAATTCATAGGGAAGAGAAACCCTATAAATGCGATGACTGTGGGAAGGCCTTTAGCTGTTCTTCATATCTGTATAAGCA

TCAGCGAATCCATACTGGCATGAAACCCTACAAATGCAAGGAATGTGGCAAGGCCTTTAACTGTTCTGCAAACCTTATTTACCACCAGAGAATTCATACT

GGAGAGAAACCATATAAGTGTGGTGAATGTGGGAAAGCCTTTACCATTTATTCAACATTTATGAATCACCAGCGAACACATAGTGGAGAAAAACCGTATG

AATGCAAAGACTGTGGGAAAGCCTTTACTAATTGTTATAATCTAATTCAACACCAAAGAATTCATACTGGAGAGAAACCCTATGCATGTGAAGAATGTGG

CAAATCTTTTAACTATTCTTCCCATCTTAAACAACACAAAAGAATCCATACTGGAGAGAAACCATATAAATGTGAAGTGTGTGGCAAAGCTTTTAACTGT

TCCGATTATCTTGTTAAGCATCAAAGAATTCATACTGGAGAGAAACCCTACAAATGTGAAGTATGTGGCAAAGCTTTTAGCTTTTCTACATATCTGCATA

AACATCAAAGAATCCACACTGGAGAGAAACGCTACAGATGTGAAGAATGTGGTAAAGCTTTTACTAATTATTCAGGGCTTATTGTTCACCGAAGAGTACA

TACTGGAGAGAAACCCTACAAATGTGAAGAATGTGGCAAGGCCTTTAGTGTTCACACATCACTCTCTAAACATCAGAGAATTCATACGAGAGAGCAACCT

TACAAATGTGATGAATGTGGAAAGACCTTTAGTGTTCACTCAACATTCTCTAAACATCAGATAATGCATACTAGAGAGAAACCCTACAAATGCAAACACT

GCGACAAGACCTTCAAATATCCTTCACCCCTTGTTCAACATGAAAGAATTCACACTGGAGAGAGACCCTACAAATGTGAAGTTTGTGGCAAGGCCTTTAC

TTCTTCTTCAAATCTTAAATATCATTGGAGACTTCATACTGGCGAGAAGCCCTATAAATGTGAACAATGTGGTAAAGCCTTTAAAAATAGTTCAAATGTC

ACTCGACACTACAAAATTCATACTAGAGAAAATCCAGATTAATGCAAACACTTTTGTAAAGCCTTCCACAGTTGTTCATTGACAATTCAGCACTAAAGAA

TTCATATAAAAGAAAAACCTTAGAAATGAAAGAAATAAGGAAAAACCTTTAATAATAGTTCAACCCATATTCAACATCCACCATTACATACTGGAGAGAT

CTTGTAATAGTGAAGAAGATGGCCGTGTTGAGCGTTCAATACTTATGGAGCATCAAATTTTTTAGAGAAACACTACAAATGCAGGTAATACAGGAACTGC

TCATTAACCATGAGTGATTTATAACCAGATGTTATACATGCAAAATGACTTTGGAAGGAACACTGACAAATACATAAAACTGAGAAAACCAAACTGGTTC

AGTAAAAAGCACTTTGTAAACAGTGTTGCAACACTTTGCTCATCATGTAAATCTTGAGAGATTGGAGAGAATTATCTATCATAAGAGACAAATTCCAGGA

GCTGTATAGGATTTAGCAAGCCACCAAGTGCTGCTCTGAATTCCTAAAGAATTAATACAGAACTCTGAACTCACTAAGAAATGTTTGGTGTGCTATAAAA

ACTCATTATAGACTTTGGAATCATGCAGATAAGTTTGTGAGGACATCAATGTGTTATAAATTGAAATTATAAGCTCAATTTTAAAAAGTGATAAGATCAC

TCAACTAGTGATTTTTATCAGTTTGTTTTTTTCCCCCCAAAGACCATAGATACATTATTGGAATATGAAGTTTAGTAACTTCTGTAAATAAAAATAAACT

GTTTTAATGT
Translation
MIIEVFINAKEMTK - UNI33297 - DPLSFTDVAIDFSADECECLDSAQWNLYKEVMLENYSNLVFLG GLAFSKPYLVTFLEQSSDLWSVKRKASV

AIHLG GSKAHKCKECGKSFDRNSVLIQHQRIHTGERPYKCEECGMAFTGRCILSKHQRIHTGEKPYKCKECGKAFSCSSNLHQHQQIHREEKPYKCDDC

GKAFSCSSYLYKHQRIHTGMKPYKCKECGKAFNCSANLIYHQRIHTGEKPYKCGECGKAFTIYSTFMNHQRTHSGEKPYECKDCGKAFTNCYNLIQHQRI

HTGEKPYACEECGKSFNYSSHLKQHKRIHTGEKPYKCEVCGKAFNCSDYLVKHQRIHTGEKPYKCEVCGKAFSFSTYLHKHQRIHTGEKRYRCEECGKAF

TNYSGLIVHRRVHTGEKPYKCEECGKAFSVHTSLSKHQRIHTREQPYKCDECGKTFSVHSTFSKHQIMHTREKPYKCKHCDKTFKYPSPLVQHERIHTGE

RPYKCEVCGKAFTSSSNLKYHWRLHTGEKPYKCEQCGKAFKNSSNVTRHYKIHTRENPD
Transcript ENSMUST00000078817
Sequence
ATCATTATGGAATTTTTTATACTGAG T GGTGAGGTTTCTAAG GACCCTCTGTCATTTACAGATGTGGCCATTGATTTCTCTGCAGATGAGTGTGAAT

GTCTGGACTCTGCTCAGTGGAATTTGTATAAGGAAGTGATGTTGGAGAATTACAGCAACCTTGTGTTCCTGG GTCTTGCTTTCTCTAAGCCATACCTGG

TCACATTTCTGGAGCAGAGTTCAGATCTGTGGAGTGTGAAGAGGAAGGCATCAGTGGCCATCCATCTAG GATCAAAAGCCCATAAATGTAAAGAATGTG

GGAAATCCTTTGATAGGAACTCAGTCCTTATTCAACATCAAAGAATTCATACTGGAGAGAGGCCCTACAAATGTGAAGAATGTGGCATGGCCTTCACCGG

TCGCTGCATTCTTTCTAAGCACCAGCGAATCCATACTGGAGAAAAACCCTACAAATGTAAAGAATGTGGCAAAGCTTTCAGCTGTTCTTCTAACCTTCAC

CAACACCAACAAATTCATAGGGAAGAGAAACCCTATAAATGCGATGACTGTGGGAAGGCCTTTAGCTGTTCTTCATATCTGTATAAGCATCAGCGAATCC

ATACTGGCATGAAACCCTACAAATGCAAGGAATGTGGCAAGGCCTTTAACTGTTCTGCAAACCTTATTTACCACCAGAGAATTCATACTGGAGAGAAACC

ATATAAGTGTGGTGAATGTGGGAAAGCCTTTACCATTTATTCAACATTTATGAATCACCAGCGAACACATAGTGGAGAAAAACCGTATGAATGCAAAGAC

TGTGGGAAAGCCTTTACTAATTGTTATAATCTAATTCAACACCAAAGAATTCATACTGGAGAGAAACCCTATGCATGTGAAGAATGTGGCAAATCTTTTA

ACTATTCTTCCCATCTTAAACAACACAAAAGAATCCATACTGGAGAGAAACCATATAAATGTGAAGTGTGTGGCAAAGCTTTTAACTGTTCCGATTATCT

TGTTAAGCATCAAAGAATTCATACTGGAGAGAAACCCTACAAATGTGAAGTATGTGGCAAAGCTTTTAGCTTTTCTACATATCTGCATAAACATCAAAGA

ATCCACACTGGAGAGAAACGCTACAGATGTGAAGAATGTGGTAAAGCTTTTACTAATTATTCAGGGCTTATTGTTCACCGAAGAGTACATACTGGAGAGA

AACCCTACAAATGTGAAGAATGTGGCAAGGCCTTTAGTGTTCACACATCACTCTCTAAACATCAGAGAATTCATACGAGAGAGCAACCTTACAAATGTGA

TGAATGTGGAAAGACCTTTAGTGTTCACTCAACATTCTCTAAACATCAGATAATGCATACTAGAGAGAAACCCTACAAATGCAAACACTGCGACAAGACC

TTCAAATATCCTTCACCCCTTGTTCAACATGAAAGAATTCACACTGGAGAGAGACCCTACAAATGTGAAGTTTGTGGCAAGGCCTTTACTTCTTCTTCAA

ATCTTAAATATCATTGGAGACTTCATACTGGCGAGAAGCCCTATAAATGTGAACAATGTGGTAAAGCCTTTAAAAATAGTTCAAATGTCACTCGACACTA

C TTCATACTAGAGAAAATCCAGATTAATGCAAACACTTTT
Translation
IIMEFFILS S GEVSK DPLSFTDVAIDFSADECECLDSAQWNLYKEVMLENYSNLVFLG GLAFSKPYLVTFLEQSSDLWSVKRKASVAIHLG GSKA

HKCKECGKSFDRNSVLIQHQRIHTGERPYKCEECGMAFTGRCILSKHQRIHTGEKPYKCKECGKAFSCSSNLHQHQQIHREEKPYKCDDCGKAFSCSSYL

YKHQRIHTGMKPYKCKECGKAFNCSANLIYHQRIHTGEKPYKCGECGKAFTIYSTFMNHQRTHSGEKPYECKDCGKAFTNCYNLIQHQRIHTGEKPYACE

ECGKSFNYSSHLKQHKRIHTGEKPYKCEVCGKAFNCSDYLVKHQRIHTGEKPYKCEVCGKAFSFSTYLHKHQRIHTGEKRYRCEECGKAFTNYSGLIVHR

RVHTGEKPYKCEECGKAFSVHTSLSKHQRIHTREQPYKCDECGKTFSVHSTFSKHQIMHTREKPYKCKHCDKTFKYPSPLVQHERIHTGERPYKCEVCGK

AFTSSSNLKYHWRLHTGEKPYKCEQCGKAFKNSSNVTRHY FILEKIQINANTF

For any suggestions or comments, please send an email to unitrap@crg.es