Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000059119 (Nap1l4)
Chromosomal location
Chr 7: 150699484 - 150734997 (-)
Description
nucleosome assembly protein 1-like 4 Gene [Source:MGI Symbol;Acc:MGI:1316687]
RefSeq_dna
NM_008672 
RefSeq_peptide
NP_032698.1 
UniGene
Mm.294625 
MGI
MGI:1316687 
Uniprot/SWISSPROT
Q78ZA7 
Uniprot/SPTREMBL
Q8C1W9 A2RSB1 
Human Ortholog
ENSG00000205531 (NAP1L4)
Omim not available
UniTrap UNI10816
Vector Insertion
Chr 7: 150734946 - 150734996
Public Clones P023E06 (ggtc) P116G08 (ggtc) D028H05 (ggtc) (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20161
Vector Insertion
Chr 7: 150727684 - 150734946
Public Clones (sanger) 5SP116G08 (ggtc) 5SE022A11 (ggtc) 3SP116G08 (ggtc) 3SD007G09 (ggtc)
CMHD-GT_419B12-3 (cmhd) IST14374A9 (tigm) IST10086E8 (tigm) IST14180H1 (tigm)
IST14408C1 (tigm) IST15000B5 (tigm) IST14518H2 (tigm) IST14180G1 (tigm)
IST11622D9 (tigm) IST10114E4 (tigm)
Private Clones OST370977 (lexicon) OST207943 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9332
Vector Insertion
Chr 7: 150726152 - 150727652
Public Clones XH584 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19854
Vector Insertion
Chr 7: 150724222 - 150726092
Public Clones IST10091C11 (tigm)
Private Clones OST378794 (lexicon) OST236335 (lexicon) OST215275 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23790
Vector Insertion
Chr 7: 150721945 - 150724121
Public Clones not available
Private Clones OST244802 (lexicon)
Severity of mutation (?) Insertion after 14% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11286
Vector Insertion
Chr 7: 150721643 - 150721802
Public Clones G073D06 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 25% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20114
Vector Insertion
Chr 7: 150720323 - 150721555
Public Clones not available
Private Clones OST372528 (lexicon) OST240254 (lexicon)
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3548
Vector Insertion
Chr 7: 150718286 - 150720190
Public Clones AQ0474 (sanger) AQ0530 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 42% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3564
Vector Insertion
Chr 7: 150704791 - 150706288
Public Clones AR0086 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 89% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000105913
Sequence
GCAGCCCCGGAGCGAGCTTAGGACAGGCGCCACTGCCGCAGGAGGCGCGAG - UNI10816 - - UNI20161 - GGGACAAAGGCGTTCAGATGGC

AGAAAACAG - UNI9332 - TCTTTCAGATGGAGGCCCTGCAGATTCTGTGGAAGCTGCTAAAAATGCCAGTAATACAG - UNI19854 - AAAAA

CTCACAGACCAGGTGATGCAGAACCCACAAGTGCTGGCAGCTTTGCAGGAACGTCTTGACAACGTCTCTCACACTCCTTCTAGTTACATAGAAAC - UN

I23790 - TTTACCTAAAGCTGTCAAAAGAAGAATTAATGCCCTGAAGCAGCTCCAGGTGAGGTGTGCGCACATAGAAGCTAAGTTCTACGAGGAAGTT

CATGACCTGGAGAGGAAGTATGCAGCCTTGTACCAGCCTCTATTTGACAAG - UNI11286 - AGAAGAGAATTCATCACTGGTGACGTGGAGCCCAC

AGATGCAGAGTCAGCGTGGCACAGTGAGAATGAGGAGGAGGACAAGTTGGCT - UNI20114 - GGAGATATGAAGAATAAAGTAGTCATAGCTGAGA

AAGAAGCAGCAACAGTGGAAGAGCTGAACCCCAAAGGCATCCCTGAGTTCTGGTTCACCATCTTCAGAAATGTGGACATGCTTAGTGAGCTGGTGCAG -

 UNI3548 - GAATATGATGAACCGATCTTGAAACATCTGCAGGATATTAAAGTGAAGTTTTCAGACCCTGGACAACCTATG TCTTTTGTGCTAGAGT

TTCACTTTGAACCCAACGACTACTTCACCAATCCTGTCCTGACGAAAACGTACAAGATGAAATCAGAGCCAGACAAGGCCGACCCGTTTTCTTTTGAAGG

TCCTGAAATTGTGGACTGTGATGG GTGTACAATAGACTGGAAGAAAGGAAAAAATGTCACAGTCAAAACCATCAAGAAAAAGCAGAAGCACAAGGGCCG

GGGCACCGTACGAACCATCACCAAGCAAGTGCCCAATGAGTCCTTCTTCAACTTCTTCAGCCCCCTGAAAG CCTCTGGAGATGGAGAATCTCTG GATG

AAGATTCCGAGTTCACCTTAGCCTCTGACTTTGAAATTGGGCACTTTTTTCGTGAGCGCATCGTGCCACGGGCTGTCCTCTACTTCACTGGGGAGGCCAT

AGAGGATGATGACAAT TTTGAAGAAGGCGAGGAAGGTGAAGAGGAG GAATTGGAAGGTGATGAAGAAGGAGAAGATGAGGATGATGCTGATGTTAACC

CCAAG - UNI3564 - AAAGAACCC CCAGCCAGCGGAGTGCAAGCAGCAGTGAGAAGCAGTGACCCTGTGGGGCCGCCTTGTGGATGGCTGTCAGGA

CCGCAGGCCGCAGGCAGGGGCCTCAGTCCCTGCCAAAGCAGAATTTTGTTGACAGTGCTGTGA
Translation
 - UNI10816 - - UNI20161 - MAENS - UNI9332 - SLSDGGPADSVEAAKNASNTE - UNI19854 - EKLTDQVMQNPQVLAALQER

LDNVSHTPSSYIET - UNI23790 - TLPKAVKRRINALKQLQVRCAHIEAKFYEEVHDLERKYAALYQPLFDK - UNI11286 - RREFITGDVE

PTDAESAWHSENEEEDKLA - UNI20114 - GDMKNKVVIAEKEAATVEELNPKGIPEFWFTIFRNVDMLSELVQ - UNI3548 - EYDEPILKHL

QDIKVKFSDPGQPM SFVLEFHFEPNDYFTNPVLTKTYKMKSEPDKADPFSFEGPEIVDCDG GCTIDWKKGKNVTVKTIKKKQKHKGRGTVRTITKQVP

NESFFNFFSPLKA ASGDGESL DEDSEFTLASDFEIGHFFRERIVPRAVLYFTGEAIEDDDN FEEGEEGEEE ELEGDEEGEDEDDADVNPK - UNI

3564 - KEP PASGVQAAVRSSDPVGPPCGWLSGPQAAGRGLSPCQSRILLTVL
Transcript ENSMUST00000072727
Sequence
AGCCCCGGAGCGAGCTTAGGACAGGCGCCACTGCCGCAGGAGGCGCGAG - UNI10816 - - UNI20161 - GGGACAAAGGCGTTCAGATGGCAG

AAAACAG - UNI9332 - TCTTTCAGATGGAGGCCCTGCAGATTCTGTGGAAGCTGCTAAAAATGCCAGTAATACAG - UNI19854 - AAAAACT

CACAGACCAGGTGATGCAGAACCCACAAGTGCTGGCAGCTTTGCAGGAACGTCTTGACAACGTCTCTCACACTCCTTCTAGTTACATAGAAAC - UNI2

3790 - TTTACCTAAAGCTGTCAAAAGAAGAATTAATGCCCTGAAGCAGCTCCAGGTGAGGTGTGCGCACATAGAAGCTAAGTTCTACGAGGAAGTTCA

TGACCTGGAGAGGAAGTATGCAGCCTTGTACCAGCCTCTATTTGACAAG - UNI11286 - AGAAGAGAATTCATCACTGGTGACGTGGAGCCCACAG

ATGCAGAGTCAGCGTGGCACAGTGAGAATGAGGAGGAGGACAAGTTGGCT - UNI20114 - GGAGATATGAAGAATAAAGTAGTCATAGCTGAGAAA

GAAGCAGCAACAGTGGAAGAGCTGAACCCCAAAGGCATCCCTGAGTTCTGGTTCACCATCTTCAGAAATGTGGACATGCTTAGTGAGCTGGTGCAG - U

NI3548 - GAATATGATGAACCGATCTTGAAACATCTGCAGGATATTAAAGTGAAGTTTTCAGACCCTGGACAACCTATG TCTTTTGTGCTAGAGTTT

CACTTTGAACCCAACGACTACTTCACCAATCCTGTCCTGACGAAAACGTACAAGATGAAATCAGAGCCAGACAAGGCCGACCCGTTTTCTTTTGAAGGTC

CTGAAATTGTGGACTGTGATGG GTGTACAATAGACTGGAAGAAAGGAAAAAATGTCACAGTCAAAACCATCAAGAAAAAGCAGAAGCACAAGGGCCGGG

GCACCGTACGAACCATCACCAAGCAAGTGCCCAATGAGTCCTTCTTCAACTTCTTCAGCCCCCTGAAAG CCTCTGGAGATGGAGAATCTCTG GATGAA

GATTCCGAGTTCACCTTAGCCTCTGACTTTGAAATTGGGCACTTTTTTCGTGAGCGCATCGTGCCACGGGCTGTCCTCTACTTCACTGGGGAGGCCATAG

AGGATGATGACAAT TTTGAAGAAGGCGAGGAAGGTGAAGAGGAG GAATTGGAAGGTGATGAAGAAGGAGAAGATGAGGATGATGCTGATGTTAACCCC

AAG - UNI3564 - GTGTAATTTTTGTGTTAATCATTCATGCGTTTCTAG AAAGAACCCAGCCAGCCAGCGGAGTGCAAGCAGCAGTGAGAAGCAGT

GACCCTGTGGGGCCGCCTTGTGGATGGCTGTCAGGACCGCAGGCCGCAGGCAGGGGCCTCAGTCCCTGCCAAAGCAGAATTTTGTTGACAGTGCTGTGAC

ATCTAACCATTTCCAAGTGCATGATTCCTCTCCCCTTTCCCTTCTTACTTTGCTAAACTTGTACAGTGGAGACTGCTGCAGTTCAGAATAGGAGATTAGT

TGTAGCACCTGCAGCTTTGGTGCCTGAAGATCACTTGGGGTGGACCGAGGTTGTGCCTGGGATTGACAGAGCCTGTGATTGTGTGCACCCGGCCCTCCCT

ACTGGCAAGGCCCCATGATTTCCAGCTGCTGAACTGCGTGGGAAGCTGCTCCAGCTGCTGTGCCCTAGTCATCGCCCAAGCACTGTAGAGGAAGCTGTGC

TCGCCTTAGAGCATTTTTTTTCTTGCGTTTTGGTTTTAGGGGTGGGTGGGTTGTGGCACACACCTCTGAGGCCAGAGCCATCGGGTTCACCCTCGTACTT

ATTTATTTACTTGTGCTTGGGGAGCTTTGGACTTCACTGTCCTCCCACTTACGAGACCATGTTGCTGACTTGATCAGGAGGATGTGACACCAAGTGGAGG

GAGGCTCATGGAGGAAGCCCTGCTGCTTCCTGCCACCAACTGCTGTGCTGTGCTGTGCTGTGCCATGCAGACTACATGTTATTGCCGCTGGAAGTTGGCA

GGCTGTAGCCAGGGGACAGAAGTTCTCCTTCACTAGGGATCTCTGGCCTGTGGAGTACAGCTTCAGCTTGTACTGTGCACACCAGGGCCACACCTGGGTT

TGGTGACCAGTTGGTGGTTGGTGTGTGTGGGGGGAGGGGTGTTTCTGAGAGTATGGTGGTGTCTCTGGTAGCCAGGACAGCCATGTCCACAGTGACCAGC

CATGTAGAGTGTGCTCAGCCTTACCCAATAACACATTTGTAACTGAATACGGTGTTTTCAATTTGTACAGAATAGTTAGGATATTCTATTAAAGTTGTGA

AACACAAACTGA
Translation
 - UNI10816 - - UNI20161 - MAENS - UNI9332 - SLSDGGPADSVEAAKNASNTE - UNI19854 - EKLTDQVMQNPQVLAALQER

LDNVSHTPSSYIET - UNI23790 - TLPKAVKRRINALKQLQVRCAHIEAKFYEEVHDLERKYAALYQPLFDK - UNI11286 - RREFITGDVE

PTDAESAWHSENEEEDKLA - UNI20114 - GDMKNKVVIAEKEAATVEELNPKGIPEFWFTIFRNVDMLSELVQ - UNI3548 - EYDEPILKHL

QDIKVKFSDPGQPM SFVLEFHFEPNDYFTNPVLTKTYKMKSEPDKADPFSFEGPEIVDCDG GCTIDWKKGKNVTVKTIKKKQKHKGRGTVRTITKQVP

NESFFNFFSPLKA ASGDGESL DEDSEFTLASDFEIGHFFRERIVPRAVLYFTGEAIEDDDN FEEGEEGEEE ELEGDEEGEDEDDADVNPK - UNI

3564 - V 

For any suggestions or comments, please send an email to unitrap@crg.es