Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000059142 (A630033E08Rik)
Chromosomal location
Chr 17: 22985997 - 23004071 (-)
Description
RIKEN cDNA A630033E08 gene Gene [Source:MGI Symbol;Acc:MGI:2445132]
RefSeq_peptide
NP_796332.2 NP_001103724.1 
UniGene
Mm.328828 
MGI
MGI:2445132 
Uniprot/SPTREMBL
Q3TGT7 Q8BNS8 Q05CI9 Q05DE2 Q66L36 
Human Ortholog
not available
Omim not available
UniTrap UNI27431
Vector Insertion
Chr 17: 23002304 - 23003947
Public Clones (sanger)
Private Clones OST59589 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000095615
Sequence
CGGTCTGGAAGTGGGGTTGGAAGAACCCGGCCGTGTATTAGGGTACCCGAAAACTTCCTTAAGACTCAGGTGCCTCTGGGAGCATTTTGGAAGCGTCAGC

AGCCCGGCAGCGGGAACCTCCCAG - UNI27431 - GTCCCCACTGCTCAGCCAGATCTGCTCACCAGTGAATCAACTAAGAACCCTGGATGGTGAAG

AGAGAGGAGACTATAGTAAAGAATCCAG AAACTTGGAAAAGAGCAATAAGAAGAATGACAGCTTCTTTGGTAAATGCTCCCCAG GAACTGTTAACATT

CAAGGAAGTGGCTGTTGACTTCTCACAGGAGGAATGGGAATGTCTTGACTGTGCTCAGAGGGCATTGTACATGGATGTGATGCTAGAGAATTACAACAAT

CTACTCTTTGTGG AGAATAATCATCATGTGTGTGTCAAACATGATGAAGTCTTGGGCCAAGGCTCAAAGTATAGTGCCCCTGAGCATGTGAATATTCAA

GAGAAGTCTAATAAATGGAAGGAATGTGGCAAAATGATTCATGAATCCTCCAAAAGTACACCTTATCAAACCAACAACAGAGATGCCTCCATTGAATCAT

CAAACAGACACAAAACTGAGAATGCCAGGGAACCATGCAAGTATAAGGACTGTGTGAATGGCTTAAATTTGTATCCCATCACTTGTCACAATCAAACAGT

GTACCTAGAAATAAAAGAACATACCAAAACACTGTATGATGAAGCTTTTCTCTCTAAATATAAACTCATGCTAAAAGGAAACAATAGTGGAATGAAATCA

CACAAGTGCAGGAAGTCTGGAAAATTCTTCACGATGACCTCAAGCCTGAGTGGGCATCCGAGAGATCATGCTAGAGAGAAGCCCTATCAATGTACAAAGT

GTAGTAAATCCTTTCTGCATTTGTCACACCTCCAACTGCATTACAAAATCCATTTTGGAGGATATCCCTACAAATGTACAGAATGCGGTAAGTGCTTTTA

TCATGCATCAGGCTTTGAAAGACATTGCAGAATCCATGCTACAAAGAATACTTACAAATGTAGTTTTTGTAGCAAATCCTTTATCTGCTGCTCAGGTCTT

AGAAAACATCAGAAAATTCATGAAGAAAACAGGCTTTTTGAATGTAACCAAGATACTAGATCATTCTGTACATTTTCCTACCGTGAATGCCATTACCGTG

CTGATATAAGAAAGAAATGTTACAGATGTAAAGAATGTGGCAAATCCCTTTCTACATCCTCAGGACTTAAAATACATCAGAGAATTCATACTGGAGAGAG

ACCTTACAAATGTGGTGACTGTGACAAATCTTTTACCCAGAAGAGCAATCTTAGAATGCATCAGAAAATTCATACAGGAGAGAATACTTACAAATGCAGT

GAATGTGACAAATGCTTTACCCAGAGATGCCTTCTTAGAACTCATCAGAGAATTCATTCAGGAGAAAAACCTTACAAATGTAGTGAATGTGGCAAGGCCT

TTGCTGGTGGCTCATATCTTAGAAGTCATCAGAGAATTCATTCAGAAAAGAAGCCTTACAAATGCAGTGACTGTGACAAATCCTTCCACCGGAAAGACCA

CCTTAGAATTCATCAGAGAATTCATACAGGAGAGAAACCTTATAAATGTAGTGAATGTGACAAATGCTTTACCCAGAAAGGCAGTGTTAGAATTCATCAG

AGAATTCATACAGGAGAGAAACCTTACAAATGTAGTAAATGTGATAAATCTTTTACCAAGAAAGACTGTCTTAAAATTCATCAGATAATTCATACAGGCG

AAGAACCTTACAAATGTAGTGAATGTGACACATCCTTTAACCGGAAAGACCATCTTAGAACTCATCAGAGATTTCACACAGGAGAGAGAATTTACAAATG

TAGTGAATGTGATGAATCCTTTACCCAGAAAATTAATCTAAGAATTCATCAGAAAATTCATACAGGAGACAACTCTTACAAATGTAGTGGATGTGACAAA

TCCTTTAACCGGAGAAACCATCTTAGAACTCATGAGAGAATTCATGCCGGAGAAAAGCCTTACAATTGTAGGGAATTTGAAAATTCCTTTATCCAGACTG

GCTCTCTTAGAATTCATCAGAGACTTCATTCAAGAAAGAAACTTTACAAATGCAGGGAATGTGACAAATCCTTTACTAGCAGCTCATATGTCAGAATACA

TCAGAGAATTCATTCAGGAGAGAAACCTTACAAATGTAGTGAGTGTGGCAAATGCTTCACTAGTGGCTCATATCTTAGAATGCACCAAAGAATTCATACA

GGAGACAAACCTTACAAATGTAGTGACTGTGATAAATGCTTTACTCAGAAATGCAGTCTTAGAATTCACCAGAGAAGTCATACAGGAGAGAAACCTTACA

AATGTGGTAATTGCGACAGATCTTTTACAAGTGGCTCATATCTTAGAATTCATCAGAGAATTCATAGAGGTGAGAAACCTCATAAATGTAGTGAATGTGA

CAAATCCTTTACCCAGAAAGGCTATCTTAGAATTCATCAGAGAATTCATAAAGGAGAAAAATCTCACAAAGGTAGTTAGTGTGAAAAATCCTTTACCCAG

AAACCCTAACTTGTGGAACTTTTCAAAGAATTCATATAGGAAAAAAAACTTAAATATAGGGAATATAGCAAATCCCTTCACAGGAAAACTGTCTTAGAAC

TTATCAGAAATTTCATACAGTAAATAAAACATACAAATGTATAGAATCTGATAAATCTTTTACCCAGAAAGGCTGTCTTAGAATTCATGAGACTTCATTC

AAGAAAGAAGCTTTATAAATGTGACAAATCTTTTACCAGGACAAACTATCTTAGAACTTGACAGAGATAACAGGAGAGAAACTTTACAAATTTGGTGAAT

ATACAAATCCTTAACTATTGGCACACCTCTTAGAATATCCCTCATGACACATAAGTTTCCACACTAGAGAATAATTATGATCAAAAGAAACTTGTGAAAA

CCTTGAGTAATGTTCAAATCTTAGAAAATACCAAGAGTTTATGCTGAGGGAAAATCTGAAAATGTGACAATGTAGGAAATTTTTTCTTCAACCTTTTTAC

TTGTTAAACTTAATACTTTGTTTGACTTTTAGTCAGTCTTTCAGCTTTGCTCAAACTTTATTAAACTTGTTCATCCTCAAATAATTCATAATGAGGACAA

AATGGAGAAGCCAGAAGAATGTGATATTGTGTAACAGTTTTCTGCAGACTGAAATGACCCATTCTGAAGGGATTGTGATTAAGACAGCAAATACATACCT

CAAAATAGCTTCAAGAAATCCCTGAAAGTGACAGCATTGTCTGCTTAAGTCAAATGATGAAACCCAGAAAAGAATATACCTCTTAAAAGAGGATTTTACA

AAGTGTCAACAAAATAGGATGCATTACTAAATGAATTATTACACATTAATTTTTCCATCTGAGAGGTATAAATGGTAGAATGTAAATACTGTTTTCAGAA

ATGTATAATTATATGCTAAACTGTTAATGTTAACCCTTATGGTGTAAAATAACTGCACTATGTATGCTGTGAGAATATCAGGCTATACTACATTTATAGA

TGGAAAATTCAGTGTACATTAGGACAAAATTCAAAACCATCTTTTAAATAATTATGATTCATCAATTATGTTAGAAAAATTTACTCTAATTTTCTTATGT

CTCCTGCGTTCATCAAAAGCACTATTCACATTGATGAATTGTTAGATTACCTTGGTCTTGTTTCTTTTTGCTGGGTATATATTTCAGTGTGCTACCCTGT

CTGTGTCAGAACACCCAATGTAGACCAAGCCTGGACTCTGCCTCCTGGATGCTAGAATTAAAGCACTGTACAGAATTTGATGATAGTTCTTATCATTATG

CACTTCATTCAGGAGGAATTGTAATGTCCAGGCCCTAATTACTGTGCTTTGTACATAGATTTGATATTGAAGAATTGCAGTAGTCATGTTTGTGTGAATG

CAAATAGCATGCTGCACTCTGTATCGAGCCTTGGGGTTCTAGTGAAAACATCAAATGTGTGATTTCTCTGGGAATGATTCATACATCTCACAGAAAAAAA

AGGAAGAACTTCAGAGTAGAAATAAACATTGCATGGTATTTTCAATTCTTC
Translation
 - UNI27431 - MVKREETIVKNPE ETWKRAIRRMTASLVNAPQ ELLTFKEVAVDFSQEEWECLDCAQRALYMDVMLENYNNLLFVE ENNHHVCV

KHDEVLGQGSKYSAPEHVNIQEKSNKWKECGKMIHESSKSTPYQTNNRDASIESSNRHKTENAREPCKYKDCVNGLNLYPITCHNQTVYLEIKEHT
Transcript ENSMUST00000088696
Sequence
CGGTCTGGAAGTGGGGTTGGAAGAACCCGGCCGTGTATTAGGGTACCCGAAAACTTCCTTAAGACTCAGGTGCCTCTGGGAGCATTTTGGAAGCGTCAGC

AGCCCGGCAGCGGGAACCTCCCAG - UNI27431 - GTCCCCACTGCTCAGCCAGATCTGCTCACCAGTGAATCAACTAAGAACCCTGGATGGTGAAG

AGAGAGGAGACTATAGTAAAGAATCCAG GTACCCACCAGCCATTTGGCTATGACTCCAGTCCCTGCAAGAGAAGCTTCCAGTAATAACTCAGAGTAATA

GTGTTTCGCGCCACATATGCGTGTTCTATATTATCCTGGTGGCAGCTGAG AAACTTGGAAAAGAGCAATAAGAAGAATGACAGCTTCTTTGGTAAATGC

TCCCCAG GAACTGTTAACATTCAAGGAAGTGGCTGTTGACTTCTCACAGGAGGAATGGGAATGTCTTGACTGTGCTCAGAGGGCATTGTACATGGATGT

GATGCTAGAGAATTACAACAATCTACTCTTTGTGG AGAATAATCATCATGTGTGTGTCAAACATGATGAAGTCTTGGGCCAAGGCTCAAAGTATAGTGC

CCCTGAGCATGTGAATATTCAAGAGAAGTCTAATAAATGGAAGGAATGTGGCAAAATGATTCATGAATCCTCCAAAAGTACACCTTATCAAACCAACAAC

AGAGATGCCTCCATTGAATCATCAAACAGACACAAAACTGAGAATGCCAGGGAACCATGCAAGTATAAGGACTGTGTGAATGGCTTAAATTTGTATCCCA

TCACTTGTCACAATCAAACAGTGTACCTAGAAATAAAAGAACATACCAAAACACTGTATGATGAAGCTTTTCTCTCTAAATATAAACTCATGCTAAAAGG

AAACAATAGTGGAATGAAATCACACAAGTGCAGGAAGTCTGGAAAATTCTTCACGATGACCTCAAGCCTGAGTGGGCATCCGAGAGATCATGCTAGAGAG

AAGCCCTATCAATGTACAAAGTGTAGTAAATCCTTTCTGCATTTGTCACACCTCCAACTGCATTACAAAATCCATTTTGGAGGATATCCCTACAAATGTA

CAGAATGCGGTAAGTGCTTTTATCATGCATCAGGCTTTGAAAGACATTGCAGAATCCATGCTACAAAGAATACTTACAAATGTAGTTTTTGTAGCAAATC

CTTTATCTGCTGCTCAGGTCTTAGAAAACATCAGAAAATTCATGAAGAAAACAGGCTTTTTGAATGTAACCAAGATACTAGATCATTCTGTACATTTTCC

TACCGTGAATGCCATTACCGTGCTGATATAAGAAAGAAATGTTACAGATGTAAAGAATGTGGCAAATCCCTTTCTACATCCTCAGGACTTAAAATACATC

AGAGAATTCATACTGGAGAGAGACCTTACAAATGTGGTGACTGTGACAAATCTTTTACCCAGAAGAGCAATCTTAGAATGCATCAGAAAATTCATACAGG

AGAGAATACTTACAAATGCAGTGAATGTGACAAATGCTTTACCCAGAGATGCCTTCTTAGAACTCATCAGAGAATTCATTCAGGAGAAAAACCTTACAAA

TGTAGTGAATGTGGCAAGGCCTTTGCTGGTGGCTCATATCTTAGAAGTCATCAGAGAATTCATTCAGAAAAGAAGCCTTACAAATGCAGTGACTGTGACA

AATCCTTCCACCGGAAAGACCACCTTAGAATTCATCAGAGAATTCATACAGGAGAGAAACCTTATAAATGTAGTGAATGTGACAAATGCTTTACCCAGAA

AGGCAGTGTTAGAATTCATCAGAGAATTCATACAGGAGAGAAACCTTACAAATGTAGTAAATGTGATAAATCTTTTACCAAGAAAGACTGTCTTAAAATT

CATCAGATAATTCATACAGGCGAAGAACCTTACAAATGTAGTGAATGTGACACATCCTTTAACCGGAAAGACCATCTTAGAACTCATCAGAGATTTCACA

CAGGAGAGAGAATTTACAAATGTAGTGAATGTGATGAATCCTTTACCCAGAAAATTAATCTAAGAATTCATCAGAAAATTCATACAGGAGACAACTCTTA

CAAATGTAGTGGATGTGACAAATCCTTTAACCGGAGAAACCATCTTAGAACTCATGAGAGAATTCATGCCGGAGAAAAGCCTTACAATTGTAGGGAATTT

GAAAATTCCTTTATCCAGACTGGCTCTCTTAGAATTCATCAGAGACTTCATTCAAGAAAGAAACTTTACAAATGCAGGGAATGTGACAAATCCTTTACTA

GCAGCTCATATGTCAGAATACATCAGAGAATTCATTCAGGAGAGAAACCTTACAAATGTAGTGAGTGTGGCAAATGCTTCACTAGTGGCTCATATCTTAG

AATGCACCAAAGAATTCATACAGGAGACAAACCTTACAAATGTAGTGACTGTGATAAATGCTTTACTCAGAAATGCAGTCTTAGAATTCACCAGAGAAGT

CATACAGGAGAGAAACCTTACAAATGTGGTAATTGCGACAGATCTTTTACAAGTGGCTCATATCTTAGAATTCATCAGAGAATTCATAGAGGTGAGAAAC

CTCATAAATGTAGTGAATGTGACAAATCCTTTACCCAGAAAGGCTATCTTAGAATTCATCAGAGAATTCATAAAGGAGAAAAATCTCACAAAGGTAGTTA

GTGTGAAAAATCCTTTACCCAGAAACCCTAACTTGTGGAACTTTTCAAAGAATTCATATAGGAAAAAAAACTTAAATATAGGGAATATAGCAAATCCCTT

CACAGGAAAACTGTCTTAGAACTTATCAGAAATTTCATACAGTAAATAAAACATACAAATGTATAGAATCTGATAAATCTTTTACCCAGAAAGGCTGTCT

TAGAATTCATGAGACTTCATTCAAGAAAGAAGCTTTATAAATGTGACAAATCTTTTACCAGGACAAACTATCTTAGAACTTGACAGAGATAACAGGAGAG

AAACTTTACAAATTTGGTGAATATACAAATCCTTAACTATTGGCACACCTCTTAGAATATCCCTCATGACACATAAGTTTCCACACTAGAGAATAATTAT

GATCAAAAGAAACTTGTGAAAACCTTGAGTAATGTTCAAATCTTAGAAAATACCAAGAGTTTATGCTGAGGGAAAATCTGAAAATGTGACAATGTAGGAA

ATTTTTTCTTCAACCTTTTTACTTGTTAAACTTAATACTTTGTTTGACTTTTAGTCAGTCTTTCAGCTTTGCTCAAACTTTATTAAACTTGTTCATCCTC

AAATAATTCATAATGAGGACAAAATGGAGAAGCCAGAAGAATGTGATATTGTGTAACAGTTTTCTGCAGACTGAAATGACCCATTCTGAAGGGATTGTGA

TTAAGACAGCAAATACATACCTCAAAATAGCTTCAAGAAATCCCTGAAAGTGACAGCATTGTCTGCTTAAGTCAAATGATGAAACCCAGAAAAGAATATA

CCTCTTAAAAGAGGATTTTACAAAGTGTCAACAAAATAGGATGCATTACTAAATGAATTATTACACATTAATTTTTCCATCTGAGAGGTATAAATGGTAG

AATGTAAATACTGTTTTCAGAAATGTATAATTATATGCTAAACTGTTAATGTTAACCCTTATGGTGTAAAATAACTGCACTATGTATGCTGTGAGAATAT

CAGGCTATACTACATTTATAGATGGAAAATTCAGTGTACATTAGGACAAAATTCAAAACCATCTTTTAAATAATTATGATTCATCAATTATGTTAGAAAA

ATTTACTCTAATTTTCTTATGTCTCCTGCGTTCATCAAAAGCACTATTCACATTGATGAATTGTTAGATTACCTTGGTCTTGTTTCTTTTTGCTGGGTAT

ATATTTCAGTGTGCTACCCTGTCTGTGTCAGAACACCCAATGTAGACCAAGCCTGGACTCTGCCTCCTGGATGCTAGAATTAAAGCACTGTACAGAATTT

GATGATAGTTCTTATCATTATGCACTTCATTCAGGAGGAATTGTAATGTCCAGGCCCTAATTACTGTGCTTTGTACATAGATTTGATATTGAAGAATTGC

AGTAGTCATGTTTGTGTGAATGCAAATAGCATGCTGCACTCTGTATCGAGCCTTGGGGTTCTAGTGAAAACATCAAATGTGTGATTTCTCTGGGAATGAT

TCATACATCTCACAGAAAAAAAAGGAAGAACTTCAGAGTAGAAATAAACATTGCATGGTATTTTCAATTCTTC
Translation
 - UNI27431 -   MTASLVNAPQ ELLTFKEVAVDFSQEEWECLDCAQRALYMDVMLENYNNLLFVE ENNHHVCVKHDEVLGQGSKYSAPEHVNIQ

EKSNKWKECGKMIHESSKSTPYQTNNRDASIESSNRHKTENAREPCKYKDCVNGLNLYPITCHNQTVYLEIKEHTKTLYDEAFLSKYKLMLKGNNSGMKS

HKCRKSGKFFTMTSSLSGHPRDHAREKPYQCTKCSKSFLHLSHLQLHYKIHFGGYPYKCTECGKCFYHASGFERHCRIHATKNTYKCSFCSKSFICCSGL

RKHQKIHEENRLFECNQDTRSFCTFSYRECHYRADIRKKCYRCKECGKSLSTSSGLKIHQRIHTGERPYKCGDCDKSFTQKSNLRMHQKIHTGENTYKCS

ECDKCFTQRCLLRTHQRIHSGEKPYKCSECGKAFAGGSYLRSHQRIHSEKKPYKCSDCDKSFHRKDHLRIHQRIHTGEKPYKCSECDKCFTQKGSVRIHQ

RIHTGEKPYKCSKCDKSFTKKDCLKIHQIIHTGEEPYKCSECDTSFNRKDHLRTHQRFHTGERIYKCSECDESFTQKINLRIHQKIHTGDNSYKCSGCDK

SFNRRNHLRTHERIHAGEKPYNCREFENSFIQTGSLRIHQRLHSRKKLYKCRECDKSFTSSSYVRIHQRIHSGEKPYKCSECGKCFTSGSYLRMHQRIHT

GDKPYKCSDCDKCFTQKCSLRIHQRSHTGEKPYKCGNCDRSFTSGSYLRIHQRIHRGEKPHKCSECDKSFTQKGYLRIHQRIHKGEKSHKGS

For any suggestions or comments, please send an email to unitrap@crg.es