Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000059146 (Ntrk3)
Chromosomal location
Chr 7: 85337445 - 85722861 (-)
Description
neurotrophic tyrosine kinase, receptor, type 3 Gene [Source:MGI (curated);Acc:Ntrk3-001]
RefSeq_dna
NM_182809 NM_008746 
RefSeq_peptide
NP_877961.1 NP_032772.3 
UniGene
Mm.464011 
MGI
MGI:97385 
Uniprot/SWISSPROT
Q6VNS1 
Uniprot/SPTREMBL
A4QPD0 A9X3Y4 Q3TNY3 Q3TP58 Q3TRX1 
Human Ortholog
ENSG00000140538 (NTRK3)
Omim not available
UniTrap UNI31916
Vector Insertion
Chr 7: 85500912 - 85595876
Public Clones IST10079G5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 57% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000039438
Sequence
GCGGCCGCGATGGTTTCCGACGCTGAAGGATTTTGCATCTGATCGTTCGGCGTTTCAAAGGCAGAGGCCCCCCTCCCCCTTCCCCCCTCCCTCGCTGTCT

TTGTTTCCTTCCCCCCCTGCTCTCCCCACTCCCCCCACCCCACCCCCCTCTCCTCTCCTCCTCCTCCTCTTTTTTAGAAGCAGCGATCGGAGATGGATGT

CTCTCTTTGCCCAGCCAAGTGTAGTTTCTGGCGGATTTTCTTGCTGGGAAGCGTCTGGCTGGACTATGTGGGCTCCGTGCTGGCTTGCCCTGCAAATTGT

GTCTGCAGCAAGACTGAGATCAATTGCCGGCGGCCGGACGATGGGAACCTCTTCCCTCTCCTGGAAGGGCAGGATTCAGGGAACAGCAATGGGAACGCCA

GCATCAACATTACGGACATCTCAAGGAATATCACTTCCAT ACACATAGAGAACTGGCGAGGCCTGCACACACTCAATGCTGTGGACATGGAGCTCTACA

CGGGACTCCAGAAGCT GACCATCAAGAATTCTGGACTCCGGAACATCCAGCCCAGAGCCTTCGCCAAGAACCCCCACTTGCGTTATAT AAACTTGTCA

AGTAACCGGCTCACCACACTCTCCTGGCAGCTCTTCCAGACGCTGAGCCTTCGGGAATT GAGACTGGAGCAGAACTTCTTCAACTGCAGCTGTGACATC

CGCTGGATGCAGCTGTGGCAGGAACAGGGGGAGGCGCGGCTGGACAGCCAGAGCCTTTACTGCATCAGTGCTGATGGCTCCCAACTCCCCCTCTTCCGCA

TGAACATCAGTCAGTGTG ATCTCCCAGAGATCAGTGTGAGCCACGTCAACCTGACTGTCCGAGAAGGAGACAATGCCGTGATCACTTGCAATGGCTCTG

GCTCTCCTTTGCCTGATGTGGACTGGATAGTCACTGGGCTGCAGTCCATCAACACCCACCAG ACCAATCTGAACTGGACCAATGTACATGCCATCAACT

TGACCCTGGTGAACGTGACGAGCGAGGACAATGGCTTCACCCTGACGTGCATTGCAGAGAACGTGGTGGGCATGAGCAATGCCAGTGTTGCTCTCACTGT

CTACT ACCCTCCACGTGTGGTGAGCCTGGTGGAGCCTGAGGTACGCCTGGAACATTGCATTGAGTTTGTGGTGCGTGGCAACCCGACACCCACGCTCCA

CTGGCTGTACAATGGACAGCCATTGAGGGAGTCCAAGATCATTCACATGGACTACTACCAGGAGGGGGAGGTCTCAGAGGGCTGCCTGCTCTTCAACAAG

CCCACCCACTACAACAATGGCAACTACACCCTCATTGCTAAGAATGCCCTGGGCACGGCCAACCAGACCATCAACGGCCACTTCCTGAAGGAGCCCTTTC

CAG AGAGCACAGATTTCTTTGACTTTG AGTCTGATGCGAGCCCTACACCTCCTATCACTGTGACCCACAAACCAGAGGAAGACACTTTTGGG - UNI

31916 - GTGTCCATAGCAGTCGGACTTGCTGCCTTTGCCTGCGTCCTTCTGGTGGTTCTCTTTATCATGATCAACAAGTATGGTCGCCGGTCCAAATT

TGGAATGAAGG - UNI31916 - GTCCTGTGGCTGTTATCAGTGGAGAGGAGGACTCAGCCAGCCCACTGCATCACATCAACCATGGCATCACTACAC

CATCATCGTTGGATGCTGGGCCTGACACAGTGGTCATTGGCATGACCCGCATCCCAGTCATTGAGAACCCCCAGTACTTCCGTCAGGGTCACAATTGCCA

CAAGCCAGACACAT - UNI31916 - GGGTCTTTTCAAACATAGACAATCATGGGATATTAAACTTGAAGGACAATAGAGATCATCTAGTCCCATCAA

CTCACTATATATATGAGGAACCTGAGGTCCAGAGTGGGGATGTGTCTTACCCAAGGTCACATG GTTTCAGAGAAATTATGTTGAATCCAATAAGCCTTT

CCGGACATTCCAAGCCTCTTAACCATGGCATCTATGTTGAGGATGTCAATGTTTATTTCAGCAAAGGACGTCATGGCTTTTAA
Translation
MDVSLCPAKCSFWRIFLLGSVWLDYVGSVLACPANCVCSKTEINCRRPDDGNLFPLLEGQDSGNSNGNASINITDISRNITSI IHIENWRGLHTLNAVD

MELYTGLQKL LTIKNSGLRNIQPRAFAKNPHLRYI INLSSNRLTTLSWQLFQTLSLREL LRLEQNFFNCSCDIRWMQLWQEQGEARLDSQSLYCISA

DGSQLPLFRMNISQCD DLPEISVSHVNLTVREGDNAVITCNGSGSPLPDVDWIVTGLQSINTHQ TNLNWTNVHAINLTLVNVTSEDNGFTLTCIAENV

VGMSNASVALTVYY YPPRVVSLVEPEVRLEHCIEFVVRGNPTPTLHWLYNGQPLRESKIIHMDYYQEGEVSEGCLLFNKPTHYNNGNYTLIAKNALGTA

NQTINGHFLKEPFPE ESTDFFDFE ESDASPTPPITVTHKPEEDTFG - UNI31916 - VSIAVGLAAFACVLLVVLFIMINKYGRRSKFGMKG - 

UNI31916 - GPVAVISGEEDSASPLHHINHGITTPSSLDAGPDTVVIGMTRIPVIENPQYFRQGHNCHKPDTW - UNI31916 - WVFSNIDNHGI

LNLKDNRDHLVPSTHYIYEEPEVQSGDVSYPRSHG GFREIMLNPISLSGHSKPLNHGIYVEDVNVYFSKGRHGF
Transcript ENSMUST00000039431
Sequence
GCGGCCGCGATGGTTTCCGACGCTGAAGGATTTTGCATCTGATCGTTCGGCGTTTCAAAGGCAGAGGCCCCCCTCCCCCTTCCCCCCTCCCTCGCTGTCT

TTGTTTCCTTCCCCCCCTGCTCTCCCCACTCCCCCCACCCCACCCCCCTCTCCTCTCCTCCTCCTCCTCTTTTTTAGAAGCAGCGATCGGAGATGGATGT

CTCTCTTTGCCCAGCCAAGTGTAGTTTCTGGCGGATTTTCTTGCTGGGAAGCGTCTGGCTGGACTATGTGGGCTCCGTGCTGGCTTGCCCTGCAAATTGT

GTCTGCAGCAAGACTGAGATCAATTGCCGGCGGCCGGACGATGGGAACCTCTTCCCTCTCCTGGAAGGGCAGGATTCAGGGAACAGCAATGGGAACGCCA

GCATCAACATTACGGACATCTCAAGGAATATCACTTCCAT ACACATAGAGAACTGGCGAGGCCTGCACACACTCAATGCTGTGGACATGGAGCTCTACA

CGGGACTCCAGAAGCT GACCATCAAGAATTCTGGACTCCGGAACATCCAGCCCAGAGCCTTCGCCAAGAACCCCCACTTGCGTTATAT AAACTTGTCA

AGTAACCGGCTCACCACACTCTCCTGGCAGCTCTTCCAGACGCTGAGCCTTCGGGAATT GAGACTGGAGCAGAACTTCTTCAACTGCAGCTGTGACATC

CGCTGGATGCAGCTGTGGCAGGAACAGGGGGAGGCGCGGCTGGACAGCCAGAGCCTTTACTGCATCAGTGCTGATGGCTCCCAACTCCCCCTCTTCCGCA

TGAACATCAGTCAGTGTG ATCTCCCAGAGATCAGTGTGAGCCACGTCAACCTGACTGTCCGAGAAGGAGACAATGCCGTGATCACTTGCAATGGCTCTG

GCTCTCCTTTGCCTGATGTGGACTGGATAGTCACTGGGCTGCAGTCCATCAACACCCACCAG ACCAATCTGAACTGGACCAATGTACATGCCATCAACT

TGACCCTGGTGAACGTGACGAGCGAGGACAATGGCTTCACCCTGACGTGCATTGCAGAGAACGTGGTGGGCATGAGCAATGCCAGTGTTGCTCTCACTGT

CTACT ACCCTCCACGTGTGGTGAGCCTGGTGGAGCCTGAGGTACGCCTGGAACATTGCATTGAGTTTGTGGTGCGTGGCAACCCGACACCCACGCTCCA

CTGGCTGTACAATGGACAGCCATTGAGGGAGTCCAAGATCATTCACATGGACTACTACCAGGAGGGGGAGGTCTCAGAGGGCTGCCTGCTCTTCAACAAG

CCCACCCACTACAACAATGGCAACTACACCCTCATTGCTAAGAATGCCCTGGGCACGGCCAACCAGACCATCAACGGCCACTTCCTGAAGGAGCCCTTTC

CAG AGAGCACAGATTTCTTTGACTTTG AGTCTGATGCGAGCCCTACACCTCCTATCACTGTGACCCACAAACCAGAGGAAGACACTTTTGGG - UNI

31916 - GTGTCCATAGCAGTCGGACTTGCTGCCTTTGCCTGCGTCCTTCTGGTGGTTCTCTTTATCATGATCAACAAGTATGGTCGCCGGTCCAAATT

TGGAATGAAGG - UNI31916 - GTCCTGTGGCTGTTATCAGTGGAGAGGAGGACTCAGCCAGCCCACTGCATCACATCAACCATGGCATCACTACAC

CATCATCGTTGGATGCTGGGCCTGACACAGTGGTCATTGGCATGACCCGCATCCCAGTCATTGAGAACCCCCAGTACTTCCGTCAGGGTCACAATTGCCA

CAAGCCAGACACAT - UNI31916 - ATGTTCAGCACATCAAGAGGAGAGACATCGTGTTGAAGAGAGAATTGGGTGAGGGAGCCTTTGGGAAGGTCT

TCCTGGCTGAGTGCTACAATCTAAGCCCCACCAAAGACAAGATGCTAGTGGCAGTGAAG GCCCTGAAGGATCCCACCTTGGCTGCCAGGAAGGATTTCC

AGAGGGAGGCTGAGCTGCTCACGAACCTGCAGCATGAGCATATTGTCAAGTTCTATGGGGTGTGTGGTGATGGTGACCCACTCATCATGGTCTTTGAATA

CATGAAGCATGGAGACCTTAACAAGTTCCTCAG GGCCCATGGGCCAGATGCCATGATCCTCGTGGATGGACAGCCACGTCAGGCCAAGGGGGAGCTAGG

GCTCTCTCAGATGCTCCACATCGCCAGTCAGATAGCCTCGGGCATGGTGTACCTGGCTTCCCAGCACTTTGTACACCGGGACCTGGCCACGAGGAACTGC

CTGGTTGGAGCCAATCTACTAGTGAAGATTGGAGATTTTGGCATGTCCAGGGACGTCTACAGTACTGATTACTACAGG GTGGGAGGACACACCATGCTC

CCCATCCGCTGGATGCCCCCTGAAAGCATAATGTACCGGAAGTTCACCACAGAGAGTGATGTCTGGAGCTTCGGGGTTATTCTTTGGGAGATCTTTACCT

ATGGGAAGCAACCATGGTTCCAGCTTTCCAACACGGAG GTCATTGAATGCATCACCCAAGGCCGTGTCTTGGAGAGACCCAGAGTCTGCCCTAAAGAAG

TGTATGATGTCATGCTGGGGTGCTGGCAGAGGGAACCACAGCAGCGGCTGAATATTAAGGAGATCTACAAAATCCTCCATGCTTTGGGGAAGGCCACCCC

GATCTACCTGGACATTCTTGGCTAG
Translation
MDVSLCPAKCSFWRIFLLGSVWLDYVGSVLACPANCVCSKTEINCRRPDDGNLFPLLEGQDSGNSNGNASINITDISRNITSI IHIENWRGLHTLNAVD

MELYTGLQKL LTIKNSGLRNIQPRAFAKNPHLRYI INLSSNRLTTLSWQLFQTLSLREL LRLEQNFFNCSCDIRWMQLWQEQGEARLDSQSLYCISA

DGSQLPLFRMNISQCD DLPEISVSHVNLTVREGDNAVITCNGSGSPLPDVDWIVTGLQSINTHQ TNLNWTNVHAINLTLVNVTSEDNGFTLTCIAENV

VGMSNASVALTVYY YPPRVVSLVEPEVRLEHCIEFVVRGNPTPTLHWLYNGQPLRESKIIHMDYYQEGEVSEGCLLFNKPTHYNNGNYTLIAKNALGTA

NQTINGHFLKEPFPE ESTDFFDFE ESDASPTPPITVTHKPEEDTFG - UNI31916 - VSIAVGLAAFACVLLVVLFIMINKYGRRSKFGMKG - 

UNI31916 - GPVAVISGEEDSASPLHHINHGITTPSSLDAGPDTVVIGMTRIPVIENPQYFRQGHNCHKPDTY - UNI31916 - YVQHIKRRDIV

LKRELGEGAFGKVFLAECYNLSPTKDKMLVAVK ALKDPTLAARKDFQREAELLTNLQHEHIVKFYGVCGDGDPLIMVFEYMKHGDLNKFLR RAHGPDA

MILVDGQPRQAKGELGLSQMLHIASQIASGMVYLASQHFVHRDLATRNCLVGANLLVKIGDFGMSRDVYSTDYYR VGGHTMLPIRWMPPESIMYRKFTT

ESDVWSFGVILWEIFTYGKQPWFQLSNTE VIECITQGRVLERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG

For any suggestions or comments, please send an email to unitrap@crg.es