Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000059383 (Gfral)
Chromosomal location
Chr 9: 76011909 - 76061464 (-)
Description
GDNF family receptor alpha like Gene [Source:MGI Symbol;Acc:MGI:3607786]
Human Ortholog
not available
Omim not available
UniTrap UNI36290
Vector Insertion
Chr 9: 76046740 - 76053298
Public Clones IST12039A1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 26% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000074880
Sequence
AACAATTGAATTTGAATACAATTAGGAAAGTTCACAGCTCAAAACAAACTGGTGAGGAACAGCTGACACCAGAAGCTGACTCTAATTGGCTGGCTCTTAG

GAAGCAAAACCTTTACACAGAAACTTCAGTTGGGATGTTGGTTGGTGTCAGTTCATCCGCCTTTCTCCCAGGGAGACCATCTTGAGTTGTCCAACATGCT

AGTGTTCATTTTCCTGG CTGTTACGTTAAGCTCAGAAAATGAATCCTCTTCCCAAACAAATGATTGTGCACATTTAATACAGAAATGCTTGATTGATGC

AAATGGCTGTGAGCAGTCATGGAGATCAATGGAAGACACCTGCCTTACTCCAG - UNI36290 - GTGACTCCTGCAAGATAAATAATTCACTACATT

GTAACCTGAGTATCCAGGCTTTGGTGGAAAAAAATTTCCAATTTAAAGAGTGTCTTTGTATGGATGACCTCCACTGTACAGTAAACAAACTTTTTGGAAA

AAAGTGCACCAATAAGACAG - UNI36290 - ATAACATGGAAAAGGACAATAAAGATAAATGGAATCTAACTACTACTCCTTTCTATCATG - UNI

36290 - GATTCAAACAGATGCAGTCTTGTTTGGAGGTGACAGAGGCGTGTGTAGGGGATGTGGTTTGTAATGCACAGTTGGCCCTTTACCTTAAAGCA

TGCTCAGCAAATGGAAATCTGTGTGATGTGAAACACTGCCAAGCAGCCATACGGTTCTTCTATCAAAATATGCCTTTTAACACTGCCCAGATGTTGGCTT

TTTGTGACTGTGCTCAATCTGATATACCCTGTCAGCAATCCAAAGAAACTCTTCACAGCAAGCCATGTGCACTGAATATAGTTCCACCCCCCACTTGCCT

CAGTGTAATTCACACTTGCCGAAATGATGAATTATGCAG GACACACTACCGAACATTCCAGACAGAATGCTGGCCCCACATAACTGGGAAGTGCCATGA

AGATGAGACCTGCATTAGCATGTTAGGCAAGCAAGACCTTACTTGTTCTGGGAGTGAGAGCTGCAGGGCTGCCTTCCTAGGAACCTTTGGGACAGTCCTG

CAAGTACCCTGTGCTTGCAGGGGCGTTACACAGGCTGAAGAACACGTGTGCATGATTTTCCAGCACATGCTTCATAGCAAATCGTGTTTCA ATTACCCA

ACTCCTAATGTCAAAGACATTTCCTCATATGAAAAAAAGAATTCAAAAGAAATTACTCTGACTGGATTCAATTCTTTCTTCAATG GAGAACTACTCTAT

GTTGTTGTGTGCATGGCAGTTACCTGTGGAATTCTTTTCTTGGTGATGCTCAAGTTAAG GATACAAAGTGAAAAAAGAGATCCCTCATCCATCGAAATA

GCTGGAGGTGTCATCATTCAGTGAGCTGCAGATCACTTACCAACCACATGTCTGTGTGACTAACCAATGGAAAATTACATTTGCCAATAACGCAATTTAA

GATGGATTTGACAATATTTAGTCATTATATGTAACAGTGACTGGTACAGTAATATACCACAATGATCACAGATCTGTTTTTGTTTTTGTTTTTAATGTTT

GAGTAAATACTTGTTGTGGTGTCATAACTAGTTGATAACATTTTCTTTAAAGACAACAGGTGTCATGTAAAATGTGACAAATTTGCTGGAAGACTATCAA

TCCACATATCAACTTCTATCTTATGGAACTAATCATAATTAGTGTGTGCAGTTTTCTGAACAAGGTTATAGTTTTCCATTAAGTTGGTAAAATTAAAATG

CTAAGTAGAATATTGAGTATACTTGTTATTTATATATTCTTACTTAGTGTCCAATCATTAAACAAATTGGTAACATTGAACATATTTAGTTAGATGACTG

CTTATGAAAATAAGAACTGACATCTTACAAATTTTATAATTTAAATAGTATTGAATTTTACTTTTTATTTGGTATGTTAAGATTCATAATATATAAAGCA

GCTACATTGGTTGAGAAAAGTCAATGGTTACTCCAGTAATGATATACTTTGTGAATTTATTTATTTTTGCTAATTAATGATCCTGAATGTAATCATGATG

AAATAAAAAAGACATACTTAAATTGCT
Translation
MLVFIFLA AVTLSSENESSSQTNDCAHLIQKCLIDANGCEQSWRSMEDTCLTPG - UNI36290 - GDSCKINNSLHCNLSIQALVEKNFQFKECLC

MDDLHCTVNKLFGKKCTNKTD - UNI36290 - DNMEKDNKDKWNLTTTPFYHG - UNI36290 - GFKQMQSCLEVTEACVGDVVCNAQLALYLK

ACSANGNLCDVKHCQAAIRFFYQNMPFNTAQMLAFCDCAQSDIPCQQSKETLHSKPCALNIVPPPTCLSVIHTCRNDELCR RTHYRTFQTECWPHITGK

CHEDETCISMLGKQDLTCSGSESCRAAFLGTFGTVLQVPCACRGVTQAEEHVCMIFQHMLHSKSCFN NYPTPNVKDISSYEKKNSKEITLTGFNSFFNG

 GELLYVVVCMAVTCGILFLVMLKLR RIQSEKRDPSSIEIAGGVIIQ

For any suggestions or comments, please send an email to unitrap@crg.es