Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000059474 (Mbtd1)
Chromosomal location
Chr 11: 93747166 - 93808299 (+)
Description
mbt domain containing 1 Gene [Source:MGI (curated);Acc:Mbtd1-009]
RefSeq_peptide
NP_598773.2 
UniGene
Mm.400978 Mm.472177 Mm.210334 Mm.406466 
MGI
MGI:2143977 
Uniprot/SWISSPROT
Q6P5G3 
Uniprot/SPTREMBL
Q5NC76 Q8BZY2 Q3TSS8 Q8C1B4 Q5NC75 A2ABG6 Q8BKW1 
Human Ortholog
ENSG00000011258 (MBTD1)
Omim not available
UniTrap UNI6937
Vector Insertion
Chr 11: 93747436 - 93747530
Public Clones RRZ512 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29977
Vector Insertion
Chr 11: 93747731 - 93748193
Public Clones D170F04 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI36019
Vector Insertion
Chr 11: 93748388 - 93752652
Public Clones (sanger) 5SE306D10 (ggtc) 3SE306D10 (ggtc) IST14640C10 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8404
Vector Insertion
Chr 11: 93748388 - 93752652
Public Clones RRK477 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1517
Vector Insertion
Chr 11: 93752703 - 93766466
Public Clones (sanger) CC0634 (sanger) IST10033B4 (tigm) IST10033A4 (tigm) IST12991D11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI22898
Vector Insertion
Chr 11: 93766472 - 93766673
Public Clones not available
Private Clones OST281674 (lexicon) OST170719 (lexicon) OST170319 (lexicon) OST130840 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5163
Vector Insertion
Chr 11: 93766673 - 93770117
Public Clones YTC226 (baygenomics)
Private Clones OST235277 (lexicon)
Severity of mutation (?) Insertion after 12% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3835
Vector Insertion
Chr 11: 93773773 - 93782680
Public Clones AX0384 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6030
Vector Insertion
Chr 11: 93794096 - 93795194
Public Clones YHD008 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 94% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12483
Vector Insertion
Chr 11: 93795194 - 93795273
Public Clones W095D02 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 94% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000063718
Sequence
CCCGAGTTAAAAGGGGGGAAATCCGGGGGCTGCCACTGCTGTCGCTGGCCCTGGCCCAGCCGGGGGTCCCCCCTGTAGTCGCCGCAGTCCCGGGGAGAGG

CACCGGCCCCCTGCTCGCGGGGGGGGAGGGGGCGCCGCGGGCTCGGGGAGCACGGACGGCCCCTACCCATGAGGCCCTGATGGAAAACACAAAGGATCTG

 - UNI29977 - AGTCGGAAGAGACACTAGAAGTCACCCAAAGCAGCCCAGCTTCTGACGAGTG - UNI8404 - - UNI36019 - GGTTTCTG

TAAGCCTCCACTCAGAGATGTGATGATCACTGCAATTAAAAA - UNI1517 - - UNI22898 - ACAGAACATTCTTCACAATCCAAAAGAAAAAG

CAGACTGGTTCGGGATGTTTGACGGCTATGATAGCTGCAGTGAGGACACAAGTAGCAGCTCCAGCTCTGAGGAGAGTGAAGAAGAAGTTGCTCCTTTACC

TTCCAATCTCCCAATCATCAAGAATAATGGACAAGTCTACACATACCCAGATGGTAAATCTGGCATGG - UNI5163 - - UNI22898 - CTACCT

GTGAGATGTGTGGGATGGTCGGTGTGCGAGATGCTTTTTACTCTAAAACGAAACGTTTCTGCAGTGTTTCCTGTTCAAGAAGTTACTCGTCAAACTCTAA

GAAGGCAAGCATTCTGGCCAGACTTCAG GGTAAGCCTCCAACAAAGAAAGCAAAAGTCCTTCAAAAACAACCTTTAGTTGCTAAATTAGCTGCCTATGC

CCAGTATCAAGCTACCTTGCAAAATCAAGCAAAGACAAAAGCAGGCAATTCTG CAATCTCTGTGGAAGGCTTCAGCTGGGGTAACTACATCAACAGCAA

CAGCTTCATAGCAGCTCCAGTGGCCTGTTTTAAGCAT - UNI3835 - GCACCTATGGGGACCTGCTGGGGTGATATCTCGGAAAATGTAAGGATAGA

AGTTCCCAATACAGACTGCAGTCTACCTACCAAAGTCTTCTGGATTGCTGGAATTATAAAATTAGCAG GTTATAATGCCCTTTTGAGATATGAAGGATT

TGAAAATGATTCTTCTCTGGACTTCTGGTGCAATATATGTGGGTCTGATATTCATCCAGTTGGTTGGTGTGCAGCTAGTGGAAAACCTCTCGTTCCTCCT

AGAA CTGTTCAACATAAATATACAAACTGGAAAGCTTTTCTAGTAAAAAGACTTACTGGTGCCAAAACACTTCCTCCTGATTTCTCACAAAAG GTTTC

TGAGAGTATGCAATATCCTTTCAAACCTTGCATGAGAGTAGAAGTAGTTGACAAGAGGCATTTATGTCGAACAAGAGTAGCAGTGGTGGAAAGTGTAATT

GGAGGACGACTACGGCTGGTGTATGAAGAGAGTGAAGATAGAACAGACGACTTCTGGTGCCACATGCACAGCCCCTTAATCCACCATATTGGATGGTCAA

GAAGCATAGGCCATCGATTCAAGAGATCAG ATATTACGAAGAAACAGGACGGACATTTCGATACACCTCCACACTTATTTGCTAAG GTAAAAGAAGTA

GACCAGAGTGGAGAATGGTTCAAAGAAGGAATGAAATTGGAAGCTATAGACCCATTAAATCTTTCTACAATATGTGTTGCCACCATTAGAAAG GTGCTG

GCTGATGGATTCCTGATGATTGGGATTGATGGCTCAGAAGCAGCAGATGGATCTGACTGGTTCTGTTATCATGCAACCTCTCCTTCCATTTTCCCTGTGG

GTTTCTGTGAAATTAACATGATAGAACTGACTCCACCCAGAG GTTACACAAAACTTCCTTTTAAATGGTTTGACTACCTCAGGGAAACCGGCTCCATTG

CAGCACCAGTAAAACTATTTAATAAG GATGTTCCAAACCACGGATTCCGTGTAGGAATGAAATTAGAAGCTGTAGATCTCATGGAGCCACGGTTAATAT

GTGTAGCCACAGTTACTCGAATTATTCACCGTCTCTTGAGGATACATTTTGATGGTTGGGAAGAAGAGTATGACCAGTGGGTAGACTGTGAGTCCCCTGA

CCTCTATCCTGTAGGGTGGTGTCAGTTAACTGGATATCAACTACAGCCTCCAGCATCACAGT - UNI6030 - - UNI12483 - CATCAAGAGAAA

GCCAATCAGCTTCTTCAAAACAGAAGAAAAAGGCTAAGTCTCAGCAATACAAAGGACATAAGAAAA - UNI12483 - GTACTGAAGAAATGACGGAG

TCTTAGCTGTAAAGTTGATAGACCATGAAGATGAACCCCAGTGCGTTCCAGAAGACTTGGTAACAGCCGTGCGTTTCTGTCTGTCTCATACAGTGACCAC

GTCACAGCTGAAGGAGGAGCTGCTGGACGGGGAGGACTATAGCTTCCTCCATGGAGCATCTGACCAGGAAAGCAATGGCTCTGCCACCGTCTACATCAAA

CAAGAGCCATGAGGCGACTCGGAAACCATGGGCAGGCGGGGCTGTTTACAGGACTGATTTGGAATCAGCCAGCTGTATAGCGGGCTATTCTACTGGGACA

TTTTGCTAAACACAGAAAAAAGTTCAGTTCCAGATTTTTCAGGTGGGGGGGAAACTATTTTGGTGGGGGGGCAATTTTTCAATTTATAAAGACGGACAAT

TTTTGTGTTGTATTTGAAGCTTTTGAAAGAATTTTGTAATATTTTCCAAGTTTGGATTTATGTGCATTGTTAACAAGAACTGAAATTATAACTTTTTTGG

TAAGATAAAAGTTTAGGTAGCAGGATTGAAGGAAATGATTAAGAAGGATATAGTTGTAAATGCAAATGAACTGTCATTACAAATGAACCTTCTTGGTACC

TGTTGGGAGATTTTTTGGATTTTAGAGTTAGGCCAGTCACATCTCCAGCTTCCTTTGCTGCGAAAATATGCAACTGAACCCCTCACAGAGGGCTCATCAC

CATGTAGATCACGGAAGGGGTCATTAATTGTGCTCGCTGACGTTTTATTGCAGCCCATTTAACTGTTTGTACAGAAACTTTTTCATTCTGCTAAAATTTA

TTTGGAGTTGTATATGAAACTAGGAGAACTCTGGATACTTTTATATGCTCTCCTTCACGTAAAGATGATTAAAATTGTCTAACACTAAAGTGTTAAACTG

GAATGGTTGACAAAGTACACAAGATCTCAGTCTACATAAAGGGTTGGGGGAAATTAGTATTTTCCTAAGTTTATTCTGTTTTCCTTGCTAGAAAAATCCC

ATAAAAGGGATATTCTTGTCAGACCTCTGCCATTTCTTCCATCTGTGAGAGAGCAACGTGATGTAACCACACCTGAGAGCAGGTACTGTCCTGTGTTACA

AAAGAATCACATGGAAAATTGTTAACCAAAATAAGTGTAGATTTCAGAATCATTCCAGCTCTACTCTTAACTGTCCTGAATTTGTTAGAAACTGATTTGA

AAGAAATGTTTCTTAAAATTCCATACACACACACACACATATTATGAATTGTCTTTAATTGTAGTCAGAATTTATTATAACAATATTTGATTTGGACCAT

TTTAAACATTCCCTATTTTAAAATTCATACGGCTTCCTTAAGAAGTAGAATGAAAGGGTAAATTGGTGACATGTTTGCTCTCTGCATTTTCTAACCTTCT

ACCGAATTGTGACTGACTCAGAGAGCTCTAGCATTTACCAGTGAGGTTCAGAAACTAAACTCTCAGGAATTCATTGCATCTGTTGTAGAAGTGCTTCTGG

GTCTGAGCCTGGCCTCCTCAGAGTGGTAATACTGCCCACTTCCTCTGGAAAATAGGCAGGGCTAATGAGAAACTAATCAAATGATTAACCTCTGCGGCCC

TTCAGCCTTTGGAATGCTTT
Translation
 - UNI29977 -  - UNI8404 - - UNI36019 - MITAIKK - UNI1517 - - UNI22898 - KQNILHNPKEKADWFGMFDGYDSCSED

TSSSSSSEESEEEVAPLPSNLPIIKNNGQVYTYPDGKSGMA - UNI5163 - - UNI22898 - ATCEMCGMVGVRDAFYSKTKRFCSVSCSRSYSS

NSKKASILARLQ GKPPTKKAKVLQKQPLVAKLAAYAQYQATLQNQAKTKAGNSA AISVEGFSWGNYINSNSFIAAPVACFKH - UNI3835 - APM

GTCWGDISENVRIEVPNTDCSLPTKVFWIAGIIKLAG GYNALLRYEGFENDSSLDFWCNICGSDIHPVGWCAASGKPLVPPRT TVQHKYTNWKAFLVK

RLTGAKTLPPDFSQK VSESMQYPFKPCMRVEVVDKRHLCRTRVAVVESVIGGRLRLVYEESEDRTDDFWCHMHSPLIHHIGWSRSIGHRFKRSD DITK

KQDGHFDTPPHLFAK VKEVDQSGEWFKEGMKLEAIDPLNLSTICVATIRK VLADGFLMIGIDGSEAADGSDWFCYHATSPSIFPVGFCEINMIELTPP

RG GYTKLPFKWFDYLRETGSIAAPVKLFNK DVPNHGFRVGMKLEAVDLMEPRLICVATVTRIIHRLLRIHFDGWEEEYDQWVDCESPDLYPVGWCQLT

GYQLQPPASQS - UNI6030 - - UNI12483 - SSRESQSASSKQKKKAKSQQYKGHKKS - UNI12483 - STEEMTES
Transcript ENSMUST00000107854
Sequence
CGAGTTAAAAGGGGGGAAATCCGGGGGCTGCCACTGCTGTCGCTGGCCCTGGCCCAGCCGGGGGTCCCCCCTGTAGTCGCCGCAGTCCCGGGGAGAGGCA

CCGGCCCCCTGCTCGCGGGGGGGGAGGGGGCGCCGCGGGCTCGGGGAGCACGGACGGCCCCTACCCATGAGGCCCTGATGGAAAACACAAAGGATCTG -

 UNI1517 - - UNI8404 - - UNI22898 - - UNI29977 - - UNI36019 - ACAGAACATTCTTCACAATCCAAAAGAAAAAGCAGACT

GGTTCGGGATGTTTGACGGCTATGATAGCTGCAGTGAGGACACAAGTAGCAGCTCCAGCTCTGAGGAGAGTGAAGAAGAAGTTGCTCCTTTACCTTCCAA

TCTCCCAATCATCAAGAATAATGGACAAGTCTACACATACCCAGATGGTAAATCTGGCATGG - UNI5163 - - UNI22898 - CTACCTGTGAGA

TGTGTGGGATGGTCGGTGTGCGAGATGCTTTTTACTCTAAAACGAAACGTTTCTGCAGTGTTTCCTGTTCAAGAAGTTACTCGTCAAACTCTAAGAAGGC

AAGCATTCTGGCCAGACTTCAG GGTAAGCCTCCAACAAAGAAAGCAAAAGTCCTTCAAAAACAACCTTTAGTTGCTAAATTAGCTGCCTATGCCCAGTA

TCAAGCTACCTTGCAAAATCAAGCAAAGACAAAAGCAGGCAATTCTG CAATCTCTGTGGAAGGCTTCAGCTGGGGTAACTACATCAACAGCAACAGCTT

CATAGCAGCTCCAGTGGCCTGTTTTAAGCAT - UNI3835 - GCACCTATGGGGACCTGCTGGGGTGATATCTCGGAAAATGTAAGGATAGAAGTTCC

CAATACAGACTGCAGTCTACCTACCAAAGTCTTCTGGATTGCTGGAATTATAAAATTAGCAG GTTATAATGCCCTTTTGAGATATGAAGGATTTGAAAA

TGATTCTTCTCTGGACTTCTGGTGCAATATATGTGGGTCTGATATTCATCCAGTTGGTTGGTGTGCAGCTAGTGGAAAACCTCTCGTTCCTCCTAGAA C

TGTTCAACATAAATATACAAACTGGAAAGCTTTTCTAGTAAAAAGACTTACTGGTGCCAAAACACTTCCTCCTGATTTCTCACAAAAG GTTTCTGAGAG

TATGCAATATCCTTTCAAACCTTGCATGAGAGTAGAAGTAGTTGACAAGAGGCATTTATGTCGAACAAGAGTAGCAGTGGTGGAAAGTGTAATTGGAGGA

CGACTACGGCTGGTGTATGAAGAGAGTGAAGATAGAACAGACGACTTCTGGTGCCACATGCACAGCCCCTTAATCCACCATATTGGATGGTCAAGAAGCA

TAGGCCATCGATTCAAGAGATCAG ATATTACGAAGAAACAGGACGGACATTTCGATACACCTCCACACTTATTTGCTAAG GTAAAAGAAGTAGACCAG

AGTGGAGAATGGTTCAAAGAAGGAATGAAATTGGAAGCTATAGACCCATTAAATCTTTCTACAATATGTGTTGCCACCATTAGAAAG GTGCTGGCTGAT

GGATTCCTGATGATTGGGATTGATGGCTCAGAAGCAGCAGATGGATCTGACTGGTTCTGTTATCATGCAACCTCTCCTTCCATTTTCCCTGTGGGTTTCT

GTGAAATTAACATGATAGAACTGACTCCACCCAGAG GTTACACAAAACTTCCTTTTAAATGGTTTGACTACCTCAGGGAAACCGGCTCCATTGCAGCAC

CAGTAAAACTATTTAATAAG GATGTTCCAAACCACGGATTCCGTGTAGGAATGAAATTAGAAGCTGTAGATCTCATGGAGCCACGGTTAATATGTGTAG

CCACAGTTACTCGAATTATTCACCGTCTCTTGAGGATACATTTTGATGGTTGGGAAGAAGAGTATGACCAGTGGGTAGACTGTGAGTCCCCTGACCTCTA

TCCTGTAGGGTGGTGTCAGTTAACTGGATATCAACTACAGCCTCCAGCATCACAGT - UNI6030 - - UNI12483 - CATCAAGAGAAAGCCAAT

CAGCTTCTTCAAAACAGAAGAAAAAGGCTAAGTCTCAGCAATACAAAGGACATAAGAAAA - UNI12483 - TGACCACGTCACAGCTGAAGGAGGAG

CTGCTGGACGGGGAGGACTATAGCTTCCTCCATGGAGCATCTGACCAGGAAAGCAATGGCTCTGCCACCGTCTACATCAAACAAGAGCCATGAGGCGACT

CGGAAACCATGGGCAGGCGGGGCTGTTTACAGGACTGATTTGGAATCAGCCAGCTGTATAGCGGGCTATTCTACTGGGACATTTTGCTAAACACAGAAAA

AAGTTCAGTTCCAGATTTTTCAGGTGGGGGGGAAACTATTTTGGTGGGGGGGCAATTTTTCAATTTATAAAGACGGACAATTTTTGTGTTGTATTTGAAG

CTTTTGAAAGAATTTTGTAATATTTTCCAAGTTTGGATTTATGTGCATTGTTAACAAGAACTGAAATTATAACTTTTTTGGTAAGATAAAAGTTTAGGTA

GCAGGATTGAAGGAAATGATTAAGAAGGATATAGTTGTAAATGCAAATGAACTGTCATTACAAATGAACCTTCTTGGTACCTGTTGGGAGATTTTTTGGA

TTTTAGAGTTAGGCCAGTCACATCTCCAGCTTCCTTTGCTGCGAAAATATGCAACTGAACCCCTCACAGAGGGCTCATCACCATGTAGATCACGGAAGGG

GTCATTAATTGTGCTCGCTGACGTTTTATTGCAGCCCATTTAACTGTTTGTACAGAAACTTTTTCATTCTGCTAAAATTTATTTGGAGTTGTATATGAAA

CTAGGAGAACTCTGGATACTTTTATATGCTCTCCTTCACGTAAAGATGATTAAAATTGTCTAACACTAAAGTGTTAAACTGGAATGGTTGACAAAGTACA

CAAGATCTCAGTCTACATAAAGGGTTGGGGGAAATTAGTATTTTCCTAAGTTTATTCTGTTTTCCTTGCTAGAAAAATCCCATAAAAGGGATATTCTTGT

CAGACCTCTGCCATTTCTTCCATCTGTGAGAGAGCAACGTGATGTAACCACACCTGAGAGCAGGTACTGTCCTGTGTTACAAAAGAATCACATGGAAAAT

TGTTAACCAAAATAAGTGTAGATTTCAGAATCATTCCAGCTCTACTCTTAACTGTCCTGAATTTGTTAGAAACTGATTTGAAAGAAATGTTTCTTAAAAT

TCCATACACACACACACACATATTATGAATTGTCTTTAATTGTAGTCAGAATTTATTATAACAATATTTGATTTGGACCATTTTAAACATTCCCTATTTT

AAAATTCATACGGCTTCCTTAAGAAGTAGAATGAAAGGGTAAATTGGTGACATGTTTGCTCTCTGCATTTTCTAACCTTCTACCGAATTGTGACTGACTC

AGAGAGCTCTAGCATTTACCAGTGAGGTTCAGAAACTAAACTCTCAGGAATTCATTGCATCTGTTGTAGAAGTGCTTCTGGGTCTGAGCCTGGCCTCCTC

AGAGTGGTAATACTGCCCACTTCCTCTGGAAAATAGGCAGGGCTAATGAGAAACTAATCAAATGATTAACCTCTGCGGCCCTTCAGCCTTTGGAATGCTT

T
Translation
 - UNI1517 - - UNI8404 - - UNI22898 - - UNI29977 - - UNI36019 - MFDGYDSCSEDTSSSSSSEESEEEVAPLPSNLPIIK

NNGQVYTYPDGKSGMA - UNI5163 - - UNI22898 - ATCEMCGMVGVRDAFYSKTKRFCSVSCSRSYSSNSKKASILARLQ GKPPTKKAKVLQ

KQPLVAKLAAYAQYQATLQNQAKTKAGNSA AISVEGFSWGNYINSNSFIAAPVACFKH - UNI3835 - APMGTCWGDISENVRIEVPNTDCSLPTK

VFWIAGIIKLAG GYNALLRYEGFENDSSLDFWCNICGSDIHPVGWCAASGKPLVPPRT TVQHKYTNWKAFLVKRLTGAKTLPPDFSQK VSESMQYPF

KPCMRVEVVDKRHLCRTRVAVVESVIGGRLRLVYEESEDRTDDFWCHMHSPLIHHIGWSRSIGHRFKRSD DITKKQDGHFDTPPHLFAK VKEVDQSGE

WFKEGMKLEAIDPLNLSTICVATIRK VLADGFLMIGIDGSEAADGSDWFCYHATSPSIFPVGFCEINMIELTPPRG GYTKLPFKWFDYLRETGSIAAP

VKLFNK DVPNHGFRVGMKLEAVDLMEPRLICVATVTRIIHRLLRIHFDGWEEEYDQWVDCESPDLYPVGWCQLTGYQLQPPASQS - UNI6030 - -

 UNI12483 - SSRESQSASSKQKKKAKSQQYKGHKKM - UNI12483 - MTTSQLKEELLDGEDYSFLHGASDQESNGSATVYIKQEP
Transcript ENSMUST00000107853
Sequence
CAGGGAAGGCCGATCTTCCGGGTGGAGGGGGAAGCGGCGTGACTGGAGTGGAAATTTTTCCCAACACAACTTCTCGGAGGCAACATATTGGAAGGGACTC

GGGGAGGCCGGAGTCCAAATGGAAGTGGCTGAAAGAAACTTCTCGCCCTGCTGATTCTGAGCCCCGCGTCGTGCCGCGCGCCCTCAATTACCTCATCGAC

TTGTGGTCTTG - UNI1517 - - UNI6937 - - UNI8404 - - UNI22898 - - UNI29977 - - UNI36019 - ACAGAACATTCTT

CACAATCCAAAAGAAAAAGCAGACTGGTTCGGGATGTTTGACGGCTATGATAGCTGCAGTGAGGACACAAGTAGCAGCTCCAGCTCTGAGGAGAGTGAAG

AAGAAGTTGCTCCTTTACCTTCCAATCTCCCAATCATCAAGAATAATGGACAAGTCTACACATACCCAGATGGTAAATCTGGCATGG - UNI5163 - 

- UNI22898 - CTACCTGTGAGATGTGTGGGATGGTCGGTGTGCGAGATGCTTTTTACTCTAAAACGAAACGTTTCTGCAGTGTTTCCTGTTCAAGAA

GTTACTCGTCAAACTCTAAGAAGGCAAGCATTCTGGCCAGACTTCAG GGTAAGCCTCCAACAAAGAAAGCAAAAGTCCTTCAAAAACAACCTTTAGTTG

CTAAATTAGCTGCCTATGCCCAGTATCAAGCTACCTTGCAAAATCAAGCAAAGACAAAAGCAGGCAATTCTG CAATCTCTGTGGAAGGCTTCAGCTGGG

GTAACTACATCAACAGCAACAGCTTCATAGCAGCTCCAGTGGCCTGTTTTAAGCAT - UNI3835 - GCACCTATGGGGACCTGCTGGGGTGATATCT

CGGAAAATGTAAGGATAGAAGTTCCCAATACAGACTGCAGTCTACCTACCAAAGTCTTCTGGATTGCTGGAATTATAAAATTAGCAG GTTATAATGCCC

TTTTGAGATATGAAGGATTTGAAAATGATTCTTCTCTGGACTTCTGGTGCAATATATGTGGGTCTGATATTCATCCAGTTGGTTGGTGTGCAGCTAGTGG

AAAACCTCTCGTTCCTCCTAGAA CTGTTCAACATAAATATACAAACTGGAAAGCTTTTCTAGTAAAAAGACTTACTGGTGCCAAAACACTTCCTCCTGA

TTTCTCACAAAAG GTTTCTGAGAGTATGCAATATCCTTTCAAACCTTGCATGAGAGTAGAAGTAGTTGACAAGAGGCATTTATGTCGAACAAGAGTAGC

AGTGGTGGAAAGTGTAATTGGAGGACGACTACGGCTGGTGTATGAAGAGAGTGAAGATAGAACAGACGACTTCTGGTGCCACATGCACAGCCCCTTAATC

CACCATATTGGATGGTCAAGAAGCATAGGCCATCGATTCAAGAGATCAG ATATTACGAAGAAACAGGACGGACATTTCGATACACCTCCACACTTATTT

GCTAAG GTAAAAGAAGTAGACCAGAGTGGAGAATGGTTCAAAGAAGGAATGAAATTGGAAGCTATAGACCCATTAAATCTTTCTACAATATGTGTTGCC

ACCATTAGAAAG GTGCTGGCTGATGGATTCCTGATGATTGGGATTGATGGCTCAGAAGCAGCAGATGGATCTGACTGGTTCTGTTATCATGCAACCTCT

CCTTCCATTTTCCCTGTGGGTTTCTGTGAAATTAACATGATAGAACTGACTCCACCCAGAG GTTACACAAAACTTCCTTTTAAATGGTTTGACTACCTC

AGGGAAACCGGCTCCATTGCAGCACCAGTAAAACTATTTAATAAG GATGTTCCAAACCACGGATTCCGTGTAGGAATGAAATTAGAAGCTGTAGATCTC

ATGGAGCCACGGTTAATATGTGTAGCCACAGTTACTCGAATTATTCACCGTCTCTTGAGGATACATTTTGATGGTTGGGAAGAAGAGTATGACCAGTGGG

TAGACTGTGAGTCCCCTGACCTCTATCCTGTAGGGTGGTGTCAGTTAACTGGATATCAACTACAGCCTCCAGCATCACAGT - UNI6030 - - UNI1

2483 - CATCAAGAGAAAGCCAATCAGCTTCTTCAAAACAGAAGAAAAAGGCTAAGTCTCAGCAATACAAAGGACATAAGAAAA - UNI12483 - T

GACCACGTCACAGCTGAAGGAGGAGCTGCTGGACGGGGAGGACTATAGCTTCCTCCATGGAGCATCTGACCAGGAAAGCAATGGCTCTGCCACCGTCTAC

ATCAAACAAGAGCCATGAGGCGACTCGGAAACCATGGGCAGGCGGGGCTGTTTACAGGACTGATTTGGAATCAGCCAGCTGTATAGCGGGCTATTCTACT

GGGACATTTTGCTAAACACAGAAAAAAGTTCAGTTCCAGATTTTTCAGGTGGGGGGGAAACTATTTTGGTGGGGGGGCAATTTTTCAATTTATAAAGACG

GACAATTTTTGTGTTGTATTTGAAGCTTTTGAAAGAATTTTGTAATATTTTCCAAGTTTGGATTTATGTGCATTGTTAACAAGAACTGAAATTATAACTT

TTTTGGTAAGATAAAAGTTTAGGTAGCAGGATTGAAGGAAATGATTAAGAAGGATATAGTTGTAAATGCAAATGAACTGTCATTACAAATGAACCTTCTT

GGTACCTGTTGGGAGATTTTTTGGATTTTAGAGTTAGGCCAGTCACATCTCCAGCTTCCTTTGCTGCGAAAATATGCAACTGAACCCCTCACAGAGGGCT

CATCACCATGTAGATCACGGAAGGGGTCATTAATTGTGCTCGCTGACGTTTTATTGCAGCCCATTTAACTGTTTGTACAGAAACTTTTTCATTCTGCTAA

AATTTATTTGGAGTTGTATATGAAACTAGGAGAACTCTGGATACTTTTATATGCTCTCCTTCACGTAAAGATGATTAAAATTGTCTAACACTAAAGTGTT

AAACTGGAATGGTTGACAAAGTACACAAGATCTCAGTCTACATAAAGGGTTGGGGGAAATTAGTATTTTCCTAAGTTTATTCTGTTTTCCTTGCTAGAAA

AATCCCATAAAAGGGATATTCTTGTCAGACCTCTGCCATTTCTTCCATCTGTGAGAGAGCAACGTGATGTAACCACACCTGAGAGCAGGTACTGTCCTGT

GTTACAAAAGAATCACATGGAAAATTGTTAACCAAAATAAGTGTAGATTTCAGAATCATTCCAGCTCTACTCTTAACTGTCCTGAATTTGTTAGAAACTG

ATTTGAAAGAAATGTTTCTTAAAATTCCATACACACACACACACATATTATGAATTGTCTTTAATTGTAGTCAGAATTTATTATAACAATATTTGATTTG

GACCATTTTAAACATTCCCTATTTTAAAATTCATACGGCTTCCTTAAGAAGTAGAATGAAAGGGTAAATTGGTGACATGTTTGCTCTCTGCATTTTCTAA

CCTTCTACCGAATTGTGACTGACTCAGAGAGCTCTAGCATTTACCAGTGAGGTTCAGAAACTAAACTCTCAGGAATTCATTGCATCTGTTGTAGAAGTGC

TTCTGGGTCTGAGCCTGGCCTCCTCAGAGTGGTAATACTGCCCACTTCCTCTGGAAAATAGGCAGGGCTAATGAGAAACTAATCAAATGATTAACCTCTG

CGGCCCTTCAGCCTTTGGAATGCTTTAAAAAAAAAAAAAAAAAAAAGAAAGTAAAAAGAATGCTAATGGAAAACCCCAGGAGACATTTTAGGTAAGATTT

TTTGTTTGACTTTTAAATGCATAGAACATTAAAAACCAGCAATTTATTTTCTAAAATATTGCTCTACTTTTGGGAATAATAGCATTGGTAATATGCACAG

GTTTACCTCATTCTATGCAAGAGGGGTTAATAACATAAGGTTTTGTAGTAGCTACTGGAAGTAAAATGTGTTACTTTTTAGTGTAAAAATGTATGGAATC

GCATGTCACCATTTTTTTAATACTGACTCTGGGGGCTAAATGCAGATCACATCAATGCAAGTTGATTCTTGTGTCAAATATATGTGAATTCAGCTGTAAA

ATTACTGGATATTTATCTTAACAGTGCTGAGAGGGACCTACTGTAAATGTGACATCCTCACACTTCCCAAATCTTTGACTTGGAAGGATCTTCCCAGAAG

CTTAAAGCCTAGAAGAGGTCCAAAGCAAAGGTCATAGCAGTCTTTATTCTCAGGCTCAGCATGAAACCCAGAACTGTGCTTCCATGGTACCAGGGCAAGA

AGCCTGTTGGATGGGGTGCTCTCCTGCCTTGGGTGGAGGAGCTCTCCAGGGAACTAACTTTAAGCCAGGAAGGATGTGATTTCAAGGCAGCCAGTCCTGG

TAATCAGTTCTGTGAAATAATCATTTGTAGCCAGGTTTTACAAGCTTCCAATTCTACACCAAAACCAGGCTTGGCGTTAGAATTCCCCGCCTACATTCAC

AAAGTGTTTATGTTCTCTAATAGTGAAGGGTTGGTAAGGACTTGCTAGAGTCCAAACAGAACCCGAAGCCCTCTTCTTTGTTAAGACCCTCGCTCCTGCT

GCTAACACAGACCGTTAACCAGAGGAGGCTTCCATCGTAGCCATAATGCCTGTCGTCGTACAGCTCAGTAGCCCGTTCTCTTTCACAGTTCAACGTGTAC

TGCCGACCTTGGACTTGTTTGTGTTTTCCTGTTAGAAGCCTGGGAACTTTTAGTAGTTTAATCTTTTTAACCATTTTCCTTGCAGTGTATGAGGAAAGCT

AAAGCTGTTATCAACTTCTTATTCTGCGGATACTAACACGGGTTTTCAGTGTTTGTTTGTTTTTATTATTAATTAATTTTGTGTGATGTGAATACCCTCG

CCCATCAATATTTGTATTATGGTGCTATATATTTGGTAATGATCCTTTAATATTGGGGAGGGATTTTAAAAATACTGTGATTAAACTGGGTATCTTCCTT

TGATTTTCATATTTTAAATAAAGCCACAGTCATTTATACAAAAAAAAAAAAAAAAAAAGCATCTGTCCCTGGGCAAACCTTTCAAGGACAGAGGCCAAAG

TAAAGTACGTAAGGTTTTTACATTGTTTCTGTGTGCGTTTGATATATAAACAATATCTGGACAAATTTAATCTTTTATTTTCTGGTAACTTGTGATTATT

GAGGAAGTGTTTGAAGCTTTCTCATGGAATGTATATAATGGCGTGAAAAATTCCTTCAGAGAAATTTATGTTCCTTTCATTTTTACCAAAATGCAAATTT

TCAGCATGGATGTGAAAAGCATTAAAATTATAACTTTGTGTACAAGATGAAAATAATTCACTAAATTTGCCCTTTTTTTACACAAAATAAAATGTTAAAG

TTAAGCTTTA
Translation
 - UNI1517 - - UNI6937 - - UNI8404 - - UNI22898 - - UNI29977 - - UNI36019 - MFDGYDSCSEDTSSSSSSEESEEE

VAPLPSNLPIIKNNGQVYTYPDGKSGMA - UNI5163 - - UNI22898 - ATCEMCGMVGVRDAFYSKTKRFCSVSCSRSYSSNSKKASILARLQ 

GKPPTKKAKVLQKQPLVAKLAAYAQYQATLQNQAKTKAGNSA AISVEGFSWGNYINSNSFIAAPVACFKH - UNI3835 - APMGTCWGDISENVRI

EVPNTDCSLPTKVFWIAGIIKLAG GYNALLRYEGFENDSSLDFWCNICGSDIHPVGWCAASGKPLVPPRT TVQHKYTNWKAFLVKRLTGAKTLPPDFS

QK VSESMQYPFKPCMRVEVVDKRHLCRTRVAVVESVIGGRLRLVYEESEDRTDDFWCHMHSPLIHHIGWSRSIGHRFKRSD DITKKQDGHFDTPPHLF

AK VKEVDQSGEWFKEGMKLEAIDPLNLSTICVATIRK VLADGFLMIGIDGSEAADGSDWFCYHATSPSIFPVGFCEINMIELTPPRG GYTKLPFKWF

DYLRETGSIAAPVKLFNK DVPNHGFRVGMKLEAVDLMEPRLICVATVTRIIHRLLRIHFDGWEEEYDQWVDCESPDLYPVGWCQLTGYQLQPPASQS -

 UNI6030 - - UNI12483 - SSRESQSASSKQKKKAKSQQYKGHKKM - UNI12483 - MTTSQLKEELLDGEDYSFLHGASDQESNGSATVYI

KQEP
Transcript ENSMUST00000021221
Sequence
CGAGTTAAAAGGGGGGAAATCCGGGGGCTGCCACTGCTGTCGCTGGCCCTGGCCCAGCCGGGGGTCCCCCCTGTAGTCGCCGCAGTCCCGGGGAGAGGCA

CCGGCCCCCTGCTCGCGGGGGGGGAGGGGGCGCCGCGGGCTCGGGGAGCACGGACGGCCCCTACCCATGAGGCCCTGATGGAAAACACAAAGGATCTG -

 UNI1517 - - UNI8404 - - UNI22898 - - UNI29977 - - UNI36019 - ACAGAACATTCTTCACAATCCAAAAGAAAAAGCAGACT

GGTTCGGGATGTTTGACGGCTATGATAGCTGCAGTGAGGACACAAGTAGCAGCTCCAGCTCTGAGGAGAGTGAAGAAGAAGTTGCTCCTTTACCTTCCAA

TCTCCCAATCATCAAGAATAATGGACAAGTCTACACATACCCAGATGGTAAATCTGGCATGG - UNI5163 - - UNI22898 - CTACCTGTGAGA

TGTGTGGGATGGTCGGTGTGCGAGATGCTTTTTACTCTAAAACGAAACGTTTCTGCAGTGTTTCCTGTTCAAGAAGTTACTCGTCAAACTCTAAGAAGGC

AAGCATTCTGGCCAGACTTCAG GGTAAGCCTCCAACAAAGAAAGCAAAAGTCCTTCAAAAACAACCTTTAGTTGCTAAATTAGCTGCCTATGCCCAGTA

TCAAGCTACCTTGCAAAATCAAGCAAAGACAAAAGCAGGCAATTCTG CAATCTCTGTGGAAGGCTTCAGCTGGGGTAACTACATCAACAGCAACAGCTT

CATAGCAGCTCCAGTGGCCTGTTTTAAGCAT - UNI3835 - GCACCTATGGGGACCTGCTGGGGTGATATCTCGGAAAATGTAAGGATAGAAGTTCC

CAATACAGACTGCAGTCTACCTACCAAAGTCTTCTGGATTGCTGGAATTATAAAATTAGCAG GTTATAATGCCCTTTTGAGATATGAAGGATTTGAAAA

TGATTCTTCTCTGGACTTCTGGTGCAATATATGTGGGTCTGATATTCATCCAGTTGGTTGGTGTGCAGCTAGTGGAAAACCTCTCGTTCCTCCTAGAA C

TGTTCAACATAAATATACAAACTGGAAAGCTTTTCTAGTAAAAAGACTTACTGGTGCCAAAACACTTCCTCCTGATTTCTCACAAAAG GTTTCTGAGAG

TATGCAATATCCTTTCAAACCTTGCATGAGAGTAGAAGTAGTTGACAAGAGGCATTTATGTCGAACAAGAGTAGCAGTGGTGGAAAGTGTAATTGGAGGA

CGACTACGGCTGGTGTATGAAGAGAGTGAAGATAGAACAGACGACTTCTGGTGCCACATGCACAGCCCCTTAATCCACCATATTGGATGGTCAAGAAGCA

TAGGCCATCGATTCAAGAGATCAG ATATTACGAAGAAACAGGACGGACATTTCGATACACCTCCACACTTATTTGCTAAG GTAAAAGAAGTAGACCAG

AGTGGAGAATGGTTCAAAGAAGGAATGAAATTGGAAGCTATAGACCCATTAAATCTTTCTACAATATGTGTTGCCACCATTAGAAAG GTTACACAAAAC

TTCCTTTTAAATGGTTTGACTACCTCAGGGAAACCGGCTCCATTGCAGCACCAGTAAAACTATTTAATAAG GATGTTCCAAACCACGGATTCCGTGTAG

GAATGAAATTAGAAGCTGTAGATCTCATGGAGCCACGGTTAATATGTGTAGCCACAGTTACTCGAATTATTCACCGTCTCTTGAGGATACATTTTGATGG

TTGGGAAGAAGAGTATGACCAGTGGGTAGACTGTGAGTCCCCTGACCTCTATCCTGTAGGGTGGTGTCAGTTAACTGGATATCAACTACAGCCTCCAGCA

TCACAGT - UNI6030 - - UNI12483 - CATCAAGAGAAAGCCAATCAGCTTCTTCAAAACAGAAGAAAAAGGCTAAGTCTCAGCAATACAAAGG

ACATAAGAAAA - UNI12483 - TGACCACGTCACAGCTGAAGGAGGAGCTGCTGGACGGGGAGGACTATAGCTTCCTCCATGGAGCATCTGACCAGG

AAAGCAATGGCTCTGCCACCGTCTACATCAAACAAGAGCCATGAGGCGACTCGGAAACCATGGGCAGGCGGGGCTGTTTACAGGACTGATTTGGAATCAG

CCAGCTGTATAGCGGGCTATTCTACTGGGACATTTTGCTAAACACAGAAAAAAGTTCAGTTCCAGATTTTTCAGGTGGGGGGGAAACTATTTTGGTGGGG

GGGCAATTTTTCAATTTATAAAGACGGACAATTTTTGTGTTGTATTTGAAGCTTTTGAAAGAATTTTGTAATATTTTCCAAGTTTGGATTTATGTGCATT

GTTAACAAGAACTGAAATTATAACTTTTTTGGTAAGATAAAAGTTTAGGTAGCAGGATTGAAGGAAATGATTAAGAAGGATATAGTTGTAAATGCAAATG

AACTGTCATTACAAATGAACCTTCTTGGTACCTGTTGGGAGATTTTTTGGATTTTAGAGTTAGGCCAGTCACATCTCCAGCTTCCTTTGCTGCGAAAATA

TGCAACTGAACCCCTCACAGAGGGCTCATCACCATGTAGATCACGGAAGGGGTCATTAATTGTGCTCGCTGACGTTTTATTGCAGCCCATTTAACTGTTT

GTACAGAAACTTTTTCATTCTGCTAAAATTTATTTGGAGTTGTATATGAAACTAGGAGAACTCTGGATACTTTTATATGCTCTCCTTCACGTAAAGATGA

TTAAAATTGTCTAACACTAAAGTGTTAAACTGGAATGGTTGACAAAGTACACAAGATCTCAGTCTACATAAAGGGTTGGGGGAAATTAGTATTTTCCTAA

GTTTATTCTGTTTTCCTTGCTAGAAAAATCCCATAAAAGGGATATTCTTGTCAGACCTCTGCCATTTCTTCCATCTGTGAGAGAGCAACGTGATGTAACC

ACACCTGAGAGCAGGTACTGTCCTGTGTTACAAAAGAATCACATGGAAAATTGTTAACCAAAATAAGTGTAGATTTCAGAATCATTCCAGCTCTACTCTT

AACTGTCCTGAATTTGTTAGAAACTGATTTGAAAGAAATGTTTCTTAAAATTCCATACACACACACACACATATTATGAATTGTCTTTAATTGTAGTCAG

AATTTATTATAACAATATTTGATTTGGACCATTTTAAACATTCCCTATTTTAAAATTCATACGGCTTCCTTAAGAAGTAGAATGAAAGGGTAAATTGGTG

ACATGTTTGCTCTCTGCATTTTCTAACCTTCTACCGAATTGTGACTGACTCAGAGAGCTCTAGCATTTACCAGTGAGGTTCAGAAACTAAACTCTCAGGA

ATTCATTGCATCTGTTGTAGAAGTGCTTCTGGGTCTGAGCCTGGCCTCCTCAGAGTGGTAATACTGCCCACTTCCTCTGGAAAATAGGCAGGGCTAATGA

GAAACTAATCAAATGATTAACCTCTGCGGCCCTTCAGCCTTTGGAATGCTTT
Translation
 - UNI1517 - - UNI8404 - - UNI22898 - - UNI29977 - - UNI36019 - MFDGYDSCSEDTSSSSSSEESEEEVAPLPSNLPIIK

NNGQVYTYPDGKSGMA - UNI5163 - - UNI22898 - ATCEMCGMVGVRDAFYSKTKRFCSVSCSRSYSSNSKKASILARLQ GKPPTKKAKVLQ

KQPLVAKLAAYAQYQATLQNQAKTKAGNSA AISVEGFSWGNYINSNSFIAAPVACFKH - UNI3835 - APMGTCWGDISENVRIEVPNTDCSLPTK

VFWIAGIIKLAG GYNALLRYEGFENDSSLDFWCNICGSDIHPVGWCAASGKPLVPPRT TVQHKYTNWKAFLVKRLTGAKTLPPDFSQK VSESMQYPF

KPCMRVEVVDKRHLCRTRVAVVESVIGGRLRLVYEESEDRTDDFWCHMHSPLIHHIGWSRSIGHRFKRSD DITKKQDGHFDTPPHLFAK VKEVDQSGE

WFKEGMKLEAIDPLNLSTICVATIRK VTQNFLLNGLTTSGKPAPLQHQ  - UNI6030 - - UNI12483 -  - UNI12483 - 
Transcript ENSMUST00000107852
Sequence
ACGAAGACAGAACATTCTTCACAATCCAAAAGAAAAAGCAGACTGGTTCGGGATGTTTGACGGCTATGATAGCTGCAGTGAGGACACAAGTAGCAGCTCC

AGCTCTGAGGAGAGTGAAGAAGAAGTTGCTCCTTTACCTTCCAATCTCCCAATCATCAAGAATAATGGACAAGTCTACACATACCCAGATGGTAAATCTG

GCATGG - UNI5163 - - UNI22898 - CTACCTGTGAGATGTGTGGGATGGTCGGTGTGCGAGATGCTTTTTACTCTAAAACGAAACGTTTCTGC

AGTGTTTCCTGTTCAAGAAGTTACTCGTCAAACTCTAAGAAGGCAAGCATTCTGGCCAGACTTCAG GGTAAGCCTCCAACAAAGAAAGCAAAAGTCCTT

CAAAAACAACCTTTAGTTGCTAAATTAGCTGCCTATGCCCAGTATCAAGCTACCTTGCAAAATCAAGCAAAGACAAAAGCAGGCAATTCTG CAATCTCT

GTGGAAGGCTTCAGCTGGGGTAACTACATCAACAGCAACAGCTTCATAGCAGCTCCAGTGGCCTGTTTTAAGCAT - UNI3835 - GCACCTATGGGG

ACCTGCTGGGGTGATATCTCGGAAAATGTAAGGATAGAAGTTCCCAATACAGACTGCAGTCTACCTACCAAAGTCTTCTGGATTGCTGGAATTATAAAAT

TAGCAG GTTATAATGCCCTTTTGAGATATGAAGGATTTGAAAATGATTCTTCTCTGGACTTCTGGTGCAATATATGTGGGTCTGATATTCATCCAGTTG

GTTGGTGTGCAGCTAGTGGAAAACCTCTCGTTCCTCCTAGAA CTGTTCAACATAAATATACAAACTGGAAAGCTTTTCTAGTAAAAAGACTTACTGGTG

CCAAAACACTTCCTCCTGATTTCTCACAAAAG GTTTCTGAGAGTATGCAATATCCTTTCAAACCTTGCATGAGAGTAGAAGTAGTTGACAAGAGGCATT

TATGTCGAACAAGAGTAGCAGTGGTGGAAAGTGTAATTGGAGGACGACTACGGCTGGTGTATGAAGAGAGTGAAGATAGAACAGACGACTTCTGGTGCCA

CATGCACAGCCCCTTAATCCACCATATTGGATGGTCAAGAAGCATAGGCCATCGATTCAAGAGATCAG ATATTACGAAGAAACAGGACGGACATTTCGA

TACACCTCCACACTTATTTGCTAAG GTAAAAGAAGTAGACCAGAGTGGAGAATGGTTCAAAGAAGGAATGAAATTGGAAGCTATAGACCCATTAAATCT

TTCTACAATATGTGTTGCCACCATTAGAAAG GTTACACAAAACTTCCTTTTAAATGGTTTGACTACCTCAGGGAAACCGGCTCCATTGCAGCACCAGTA

AAACTATTTAATAAG GATGTTCCAAACCACGGATTCCGTGTAGGAATGAAATTAGAAGCTGTAGATCTCATGGAGCCACGGTTAATATGTGTAGCCACA

GTTACTCGAATTATTCACCGTCTCTTGAGGATACATTTTGATGGTTGGGAAGAAGAGTATGACCAGTGGGTAGACTGTGAGTCCCCTGACCTCTATCCTG

TAGGGTGGTGTCAGTTAACTGGATATCAACTACAGCCTCCAGCATCACAGTGTAAGTTACTATATAGAAAACATGTTCTTTTATTTTACAAAAAAAAAAA

AAAAAACCTGCAAATTCTCCATAGAACTATCTCATATCTCAGAGGGCAAGCTCACAGGACAAGAATATATCAATGTCTGATGAGTTGCCAGGTAAAATCC

CAAGACCCAACAATATCACAGAATTAGACTGTGTATGCCATGGCAATGTGAACTCCATATTGGTGACATAAAAGTAAAATAGAAAAAAACAGAAGTTACC

AAATTAAACTACACTACTGTTGAGCTGCATATTATAGGCTGAAAATGCATTGTTCATAAATGCTGTTGAGTAAATAGT
Translation
MFDGYDSCSEDTSSSSSSEESEEEVAPLPSNLPIIKNNGQVYTYPDGKSGMA - UNI5163 - - UNI22898 - ATCEMCGMVGVRDAFYSKTKRF

CSVSCSRSYSSNSKKASILARLQ GKPPTKKAKVLQKQPLVAKLAAYAQYQATLQNQAKTKAGNSA AISVEGFSWGNYINSNSFIAAPVACFKH - UN

I3835 - APMGTCWGDISENVRIEVPNTDCSLPTKVFWIAGIIKLAG GYNALLRYEGFENDSSLDFWCNICGSDIHPVGWCAASGKPLVPPRT TVQH

KYTNWKAFLVKRLTGAKTLPPDFSQK VSESMQYPFKPCMRVEVVDKRHLCRTRVAVVESVIGGRLRLVYEESEDRTDDFWCHMHSPLIHHIGWSRSIGH

RFKRSD DITKKQDGHFDTPPHLFAK VKEVDQSGEWFKEGMKLEAIDPLNLSTICVATIRK VTQNFLLNGLTTSGKPAPLQHQ 
Transcript ENSMUST00000063645
Sequence
GCGGGGTGGGCACGTGTGGGAGGGAGACGTAGGAGTGGTATCGGGGAGTCAGCCGCCAAGGCTGCTACTTGAGGGTTCCAAGTCAGTGGGCTTCCACCAT

CCGTACGTTCTCCTTTGTGAAAAAGAAATCCTGACATTTCAGAGTCGGAAGAGACACTAGAAGTCACCCAAAGCAGCCCAGCTTCTGACGAGTG - UNI

1517 - - UNI8404 - - UNI22898 - - UNI36019 - ACAGAACATTCTTCACAATCCAAAAGAAAAAGCAGACTGGTTCGGGATGTTTGAC

GGCTATGATAGCTGCAGTGAGGACACAAGTAGCAGCTCCAGCTCTGAGGAGAGTGAAGAAGAAGTTGCTCCTTTACCTTCCAATCTCCCAATCATCAAGA

ATAATGGACAAGTCTACACATACCCAGATGGTAAATCTGGCATGG - UNI5163 - - UNI22898 - CTACCTGTGAGATGTGTGGGATGGTCGGT

GTGCGAGATGCTTTTTACTCTAAAACGAAACGTTTCTGCAGTGTTTCCTGTTCAAGAAGTTACTCGTCAAACTCTAAGAAGGCAAGCATTCTGGCCAGAC

TTCAG GGTAAGCCTCCAACAAAGAAAGCAAAAGTCCTTCAAAAACAACCTTTAGTTGCTAAATTAGCTGCCTATGCCCAGTATCAAGCTACCTTGCAAA

ATCAAGCAAAGACAAAAGCAGGCAATTCTG CAATCTCTGTGGAAGGCTTCAGCTGGGGTAACTACATCAACAGCAACAGCTTCATAGCAGCTCCAGTGG

CCTGTTTTAAGCAT - UNI3835 - GCACCTATGGGGACCTGCTGGGGTGATATCTCGGAAAATGTAAGGATAGAAGTTCCCAATACAGACTGCAGTC

TACCTACCAAAGTCTTCTGGATTGCTGGAATTATAAAATTAGCAG GTTATAATGCCCTTTTGAGATATGAAGGATTTGAAAATGATTCTTCTCTGGACT

TCTGGTGCAATATATGTGGGTCTGATATTCATCCAGTTGGTTGGTGTGCAGCTAGTGGAAAACCTCTCGTTCCTCCTAGAA CTGTTCAACATAAATATA

CAAACTGGAAAGCTTTTCTAGTAAAAAGACTTACTGGTGCCAAAACACTTCCTCCTGATTTCTCACAAAAG GTTTCTGAGAGTATGCAATATCCTTTCA

AACCTTGCATGAGAGTAGAAGTAGTTGACAAGAGGCATTTATGTCGAACAAGAGTAGCAGTGGTGGAAAGTGTAATTGGAGGACGACTACGGCTGGTGTA

TGAAGAGAGTGAAGATAGAACAGACGACTTCTGGTGCCACATGCACAGCCCCTTAATCCACCATATTGGATGGTCAAGAAGCATAGGCCATCGATTCAAG

AGATCAG ATATTACGAAGAAACAGGACGGACATTTCGATACACCTCCACACTTATTTGCTAAG GTAAAAGAAGTAGACCAGAGTGGAGAATGGTTCAA

AGAAGGAATGAAATTGGAAGCTATAGACCCATTAAATCTTTCTACAATATGTGTTGCCACCATTAGAAAG GTGCTGGCTGATGGATTCCTGATGATTGG

GATTGATGGCTCAGAAGCAGCAGATGGATCTGACTGGTTCTGTTATCATGCAACCTCTCCTTCCATTTTCCCTGTGGGTTTCTGTGAAATTAACATGATA

GAACTGACTCCACCCAGAGGTACTCCATTCTGGTATAAACACTCAGTTTCTAGCCTTGCTTTGTTTTTGTGTGTTAATCTGCTTACATTTAACATAGCCC

TAATCTTAGTTGTTGTACGTGTATTTATACACAGTATGTATGAGTATGTATAAGTAGACTAAAACATACAAGAGCTGTGAGATATTCTGAAGCCAAGCCT

GGTAGTACATGCCTGAAATCCCAGCACTTGGGAGCAAAGCCAGGATGATCGACTACAAGTTGGAAACTTGCCTATTCTATATAGTGAGTACAGGCCAGTC

AGGGCTATACAACAAGACCCTGTCTCAATGTTAATACATTAAAGTAAAAATACAATCTTTGGGTGCTAGAGAGATGGCTCAGGGGTTAAGAGCACTGACT

ATTCTTCCAGAGGACCAGGGTTCAAATCCCAGCACCCACATGGCAGCTCACATATGTCTGTAACTCCAGGATCTGACATTCTCACACAGAAATACAGGCA

AAACACCAATACACATAAAATAAAAAGTTTTAAAAC
Translation
 - UNI1517 - - UNI8404 - - UNI22898 - - UNI36019 - MFDGYDSCSEDTSSSSSSEESEEEVAPLPSNLPIIKNNGQVYTYPDGKS

GMA - UNI5163 - - UNI22898 - ATCEMCGMVGVRDAFYSKTKRFCSVSCSRSYSSNSKKASILARLQ GKPPTKKAKVLQKQPLVAKLAAYAQ

YQATLQNQAKTKAGNSA AISVEGFSWGNYINSNSFIAAPVACFKH - UNI3835 - APMGTCWGDISENVRIEVPNTDCSLPTKVFWIAGIIKLAG 

GYNALLRYEGFENDSSLDFWCNICGSDIHPVGWCAASGKPLVPPRT TVQHKYTNWKAFLVKRLTGAKTLPPDFSQK VSESMQYPFKPCMRVEVVDKRH

LCRTRVAVVESVIGGRLRLVYEESEDRTDDFWCHMHSPLIHHIGWSRSIGHRFKRSD DITKKQDGHFDTPPHLFAK VKEVDQSGEWFKEGMKLEAIDP

LNLSTICVATIRK VLADGFLMIGIDGSEAADGSDWFCYHATSPSIFPVGFCEINMIELTPPRGTPFWYKHSVSSLALFLCVNLLTFNIALILVVVRVFI

HSMYEYV
Transcript ENSMUST00000107850
Sequence
CTTCCGGGTGGAGGGGGAAGCGGCGTGACTGGAGTGGAAATTTTTCCCAACACAACTTCTCGGAGGCAACATATTGGAAGGGACTCGGGGAGGCCGGAGT

CCAAATGGAAGTGGCTGAAAGAAACTTCTCGCCCTGCTGATTCTGAGCCCCGCGTCGTGCCGCGCGCCCTCAATTACCTCATCGACTTGTGGTCTTGGTA

CGGTCCTTAGAGTACGGCGCCTGCCGAGGGTCCCACGCTGGAGGGGAGAGAGGAGG - UNI1517 - - UNI6937 - - UNI8404 - - UNI22

898 - - UNI29977 - - UNI36019 - ACAGAACATTCTTCACAATCCAAAAGAAAAAGCAGACTGGTTCGGGATGTTTGACGGCTATGATAGCT

GCAGTGAGGACACAAGTAGCAGCTCCAGCTCTGAGGAGAGTGAAGAAGAAGTTGCTCCTTTACCTTCCAATCTCCCAATCATCAAGAATAATGGACAAGT

CTACACATACCCAGATGGTAAATCTGGCATGG - UNI5163 - - UNI22898 - CTACCTGTGAGATGTGTGGGATGGTCGGTGTGCGAGATGCTT

TTTACTCTAAAACGAAACGTTTCTGCAGTGTTTCCTGTTCAAGAAGTTACTCGTCAAACTCTAAGAAGGCAAGCATTCTGGCCAGACTTCAG GGTAAGC

CTCCAACAAAGAAAGCAAAAGTCCTTCAAAAACAACCTTTAGTTGCTAAATTAGCTGCCTATGCCCAGTATCAAGCTACCTTGCAAAATCAAGCAAAGAC

AAAAGCAGGCAATTCTG CAATCTCTGTGGAAGGCTTCAGCTGGGGTAACTACATCAACAGCAACAGCTTCATAGCAGCTCCAGTGGCCTGTTTTAAGCA

T - UNI3835 - GCACCTATGGGGACCTGCTGGGGTGATATCTCGGAAAATGTAAGGATAGAAGTTCCCAATACAGACTGCAGTCTACCTACCAAAGT

CTTCTGGATTGCTGGAATTATAA
Translation
 - UNI1517 - - UNI6937 - - UNI8404 - - UNI22898 - - UNI29977 - - UNI36019 - MFDGYDSCSEDTSSSSSSEESEEE

VAPLPSNLPIIKNNGQVYTYPDGKSGMA - UNI5163 - - UNI22898 - ATCEMCGMVGVRDAFYSKTKRFCSVSCSRSYSSNSKKASILARLQ 

GKPPTKKAKVLQKQPLVAKLAAYAQYQATLQNQAKTKAGNSA AISVEGFSWGNYINSNSFIAAPVACFKH - UNI3835 - APMGTCWGDISENVRI

EVPNTDCSLPTKVFWIAGII

For any suggestions or comments, please send an email to unitrap@crg.es