Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000059495 (Arhgef12)
Chromosomal location
Chr 9: 42771926 - 42913569 (-)
Description
Rho guanine nucleotide exchange factor (GEF) 12 Gene [Source:MGI Symbol;Acc:MGI:1916882]
RefSeq_peptide
NP_081420.2 
UniGene
Mm.415694 Mm.450945 Mm.475265 
MGI
MGI:1916882 
Uniprot/SWISSPROT
Q8R4H2 
Human Ortholog
ENSG00000196914 (ARHGEF12)
Omim not available
UniTrap UNI14673
Vector Insertion
Chr 9: 42852346 - 42913570
Public Clones FHCRC-GT-S1-12B1 (fhcrc)
Private Clones OST352097 (lexicon) OST345334 (lexicon) OST345114 (lexicon) OST266724 (lexicon)
OST159782 (lexicon) OST145891 (lexicon) OST118586 (lexicon) OST91140 (lexicon)
OST58838 (lexicon) OST35571 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18745
Vector Insertion
Chr 9: 42850760 - 42852346
Public Clones not available
Private Clones OST415227 (lexicon) OST110517 (lexicon)
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19528
Vector Insertion
Chr 9: 42835379 - 42848622
Public Clones IST14995A3 (tigm)
Private Clones OST389540 (lexicon) OST350891 (lexicon) OST225050 (lexicon) OST128351 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23289
Vector Insertion
Chr 9: 42834313 - 42835279
Public Clones not available
Private Clones OST266729 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI297
Vector Insertion
Chr 9: 42801205 - 42805656
Public Clones GC0492 (tigem)
Private Clones not available
Severity of mutation (?) Insertion after 44% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5773
Vector Insertion
Chr 9: 42794671 - 42797042
Public Clones CSI387 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 57% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5626
Vector Insertion
Chr 9: 42790132 - 42792456
Public Clones CSI823 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 62% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28303
Vector Insertion
Chr 9: 42777276 - 42777795
Public Clones not available
Private Clones OST34473 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000072767
Sequence
TCCGTGCCTTGCTGAGGATCGTTCTTAGTTCTTGAGCTCGCCTTGTGGCCGACTTGCTCGGTTTGTTTGGGGAGATAACTTGTTTTGCCTCAGCCCGCAT

CCCCTTTCCTTGACCCCTTGCAATCGGATGTTCTAGATGACTGAATGGAGTTTTGAGTTGGACTTTTGTGTCCCTGCCGAAATTGGGCCTGATCCCAGAG

CACTGGGGGTGGGGTGTGGAGGTGTTACTGTAAAATGCAAGTTGGATAAAAAGAAGACCTCTCGCCAAGGGCCCCAATGAGTGGCACACAGTCTACTATC

ACGGACAG - UNI14673 - GTTTCCCCTCAAAAAACCTATAAG - UNI14673 - - UNI18745 - GCATGGAAGTATTTTGAACCGAGAGTC

ACCAACAGATAAGAAACAGAAAGTTGAACGCAGTTCATCGCATGATTTTGACCCCACAG ATAGCTCCTCCAAGAAGACAAAGTCTAGTTCAGAGGAGAG

TAGATCCGAGATCTATG - UNI19528 - GTCTTGTTCAGCGCTGTGTGATCATCCAGAAAGACGACAATGGCTTCGGGCTGACAGTCAGTGGAGACA

ATCCGGTCTTCGTACAATCTGTCAAAGAAG - UNI23289 - ATGGAGCAGCCATGCGTGCTGGAGTACAAACAGGTGATCGAATCATCAAG GTGAA

TGGTACTCTGGTGACTCATTCAAATCATCTGGAGGTGGTGAAACTAATCAGAT CTGGTTCCTATGTAGCTCTCACTGTCCAGGGACGCCCACCTGGGTC

GCCCCAGATCCCACTTGCTGATTCTGAAGTAGAGCCATCAGTCACTGGACATATGTCTCCCATTATGACATCCCCTCATTCCCCTGGAGCAGCCGGGAAT

ATGGAGAGAATCACCAGTCCTGTGCTCGTGGGG GAGGAAAACAATGTGGTCCATAACCAGAAAGTAGAGATTCTGAGAAAGATGTTACAGAAGGAACAG

GAACGGCTGCAG TTGCTGCAGGAAGATTACAACCGAACGGCTACCCAAAGATTGCTCAAGGAGATCCAGGAGGCCAAGAAGCACATCCCGCAGCTGCAG

GAGCAGCTGTCCAAAGCCACGGGCTCTGCTCAG GACGGAGCTGTAATTGCACCCTCCAGGCCATTAGGTGATGCCCTAACACTCAGTGAGGCAGAAGCA

GATCCTGGAGATGGCCTGTGCAGGACTGACTGGAGCAGTGGAGATGCTTCTCGGCCCAGTAGTGACAGTGCTGAT AGTCCCAAGAGTAGCCTGAGAGAA

AGGAGTTACCTGGAGGAAGCCCCAGAGAGAAGTGAAGGAGTTCAGGACGCT CAGGAGCCGCAGTCGCTGGTCGGCAGTCCCTCCACCCGGGGCGCCCCT

CACATCATTGGAGCAGAGGATGATGATTTTGGTACTGAGCATGAGCAG ATCAATGGACAGTGCAGCTGTTTCCAGAGCATTGAATTGCTGAAGTCTCGC

CCTGCTCACTTGGCTGTTTTCTTACACCATGTAGTCTCACAGTTTGACCCTGCAACATTG CTCTGTTATCTCTATTCAGACCTGTATAAGCAGACAAAC

TCCAAGGAGACTCGGCGTGTCTTCCTGGAGTTTCATCAGTTCTTCTTGGACCGGTCTGCA CACCTGAAGGTTCCAGTTCCTGAGGAAATCTCCGTGGAT

CTAG AAAAGAGAAGACCTGAGCTTATTCCTGAGGATCTGCATCGCCTCTACATTCAGACAATGCAGGAGAGAGTCCACCCTGAAGTTCAGAGGCACTTG

GAGGATTTCCG ACAGAAACGCAGCATGGGGCTGACCTTGGCTGAGAGTGAGCTGACTAAACTTGATGCAGAGAGAGACAAGGACCGGGGAACTCTGGAG

AAGGAGCGAGCATGTGCGGAACAGATCGTTACCAAAATTGAAGAAGTGTT GATGACTGCTCAGGCTGTAGAAGAAGAAAGGAG TTCCACAATGCAGTA

TGTAATTCTCATGTATATGAAGTATTTGGGAGTAAAAGTGAAAGAACCTCGAAACTTGGAGCACAAGCGGGGTCGGATCGGCTTCCTTCCAAAGATCAAG

 CAAAGCATGAAGAAAGATAGAGAGGGCGAAGAAAAAGGGAAGCGAAGAGGATTCCCCAGCATTTTGGGACCCCCAAGAAGACCAAGCCGCCACGACAAC

AGTGCAA TTGGCAGGGCCATGGAGATACAGAAGTCACGCCACCCGAAGCACTTATCCACTCCCTCGTCTGTGAGTCCTGAGCCTCAGGACCCTGCCAAG

TTGCGCCAGAGTGGAGTAGCCAATGAAGGAACAGACACTGGATACCTGCCCGCCAGTTCCATGTCCTCTGCCACCTCAGGGACTGCTCTTTCCCAAGAGG

GAGGGAGAGAGAATGATACAG - UNI297 - GAACAAAACAAGTGGGAGAAGCATCGGCGCCTGGAGACTGCTTGGACAGCACACCTCGAGTCCCCAC

TACTGTTTTCGACTTCCCTCCTCCTCTATTAGATCAAGTGCAGGAGGAGGAGTGTGAAGTAGAGAG GGTGGCAGAACATGGGACCCCAAAACCCTTTCG

GAA GTTTGACAGCATCGCCTTTGGAGAAAGTCAGAGTGAGGATGAGCAGTTTGAAAATGACCTGGAGACAGATCCACCCAACTGGCAGCAGCTTGTTAG

CAGAGAAGTGTTACTGGGACTGAAACCTTCTGAGATCAAAAGACAGGAAGTGATTAATG AATTGTTCTACACTGAGAGAGCTCATGTCCGGACACTGAA

GGTTCTTGACCAAGTATTCTATCAGCGAGTGTCCAGAGAAGGGATTCTATCACCTTCAGAACTACGCAAGATTTTTTCAAACTTGGAAGATATCCTTCAA

CTTCATG TTGGGTTGAATGAGCAAATGAAAGCTGTCCGAAAAAGGAATGAAACTTCTGTTATTGATCATATTGGGGAAGATCTGCTCATCTGG - UNI

5773 - TTTAGTGGACCAGGAGAGGAGAAGCTGAAACATGCTGCTGCCACATTCTGCAGTAACCAACCTTTCGCCCTGGAAATGATCAAGTCTCGCCAG

AAAAAGGATTCTCGATTCCATACTTTTGTGCAA GACGCTGAGAGTAACCCCCTGTGCCGTCGTCTTCAGCTGAAGGACATCATTCCCACCCAAATGCAG

AGACTCACTAAGTACCCGCTTCTTTTGGATAACATTGCCAAGTACACAG - UNI5626 - AATGGCCTCCAGAAAGGGAAAAGGTGAAGAAGGCTGCA

GACCATTGTCGTCAGATCTTAAATTATGTAAATCAGGCTGTCAGGGAGGCAGAAAACAAGCAG CGCTTAGAAGACTATCAGCGTCGCCTTGACACCTCC

AATCTCAAGTTGTCCGAGTACCCAAATGTTGACGAGCTCAGG AATTTGGATTTAACAAAAAGAAAGATGATTCATGAAGGGCCGTTGGTCTGGAAGGTG

AATAGAGATAAAAGCATCG ATCTTTATACACTGCTGCTGGAAGACATCCTTGTGCTGCTACAGAAGCAGGATGACAGGCTGGTGCTAAGGTGCCACAGC

AAGATTCTGGCATCCACAGCCGACAGCAAACACACCTTCAGCCCTGTCATTAAGCTGAGCACGGTGCTGGTTCGGCAGGTGGCGACAG ATAACAAAGCT

TTATTCGTCATCTCCATGTCAGATAATGGAGCCCAAATTTATGAATTGGTAGCACAGACGGTTTCTGAAAAGACAGT CTGGCAAGACCTCATCTGTCGA

ATGGCTGCGTCAGTGAAGGAGCAGTCTACAAAGCCGATTCCCCTCCCACAGCCGCCACCTTGCGA AGGAGACAATGATGAAGAAGAACCAGCCAAGTTA

AAAGTGGAGCACCATGATCTTTCAGTCGCTGGTCTGCAAAGTCCAG ACAGAGTTTTGGGATTAGAATCTCCCTTAATTTCGTCAAAGCCTCAGTCTCAT

TCACTGAATACCCCTGGCAAATCAGCGGCAGAACATCTCTTTGTGACCGCAACACAGTTTGCAAAGGAACAGCATGCAAATGGGGCACTCAAGGAAGGTG

ATGGCGGGTATCCAGTCACAATCCCAGGTCCACACTTGCCTGTGTCAGAGGAGCGGTGGGCATTGGACGCACTGAGAAATT TGGGCTTGTTGAAGCAGT

TGCTGGTACAGCAGTTAGGTCTCACCGAGAAGAGTACTCAGGAAGACTGGCAGTCCTTCTCACGATACGGGCCAGCTTCTGAAGAGGTACAGGCAGACAG

TGGCATCCGGGACTTGGAAAATGTTAAGGCTTGTCATGCCAGGGAAGGACAGATGTCTTTTAAAACTGGAACTGGTGATATTGCAACTTGTGACAGTCCA

CGGACTTCAACTGAGTCTTGTGCTGCACAGGATTCAGTGATACTGGCATCCCAAGACAGCCAGGCAAGTAACGTTTTAGTAATGGACCACATGATCCTGA

CCCCAGAGATGCCTCCTGCAGAGCCAGAAGGGGGTCTGGATGAGAGTGGAGAGCACTTTTTTGATGCCCGTGAAGCACATAGTGATGATAATCCATCAGA

AGGTGATGGAGCAGTTAAAAAGGAAGAGAAGGATGTTAATTTACGCATCTCAG GAAACTGTTTGATCCTTGATGGCTATGATGCAGTTCAGGAGAGCTC

CACAGATGAGGAGGTTGCCTCCTCGTTCCCCCTGCAGCCTGTGACGGGCATCCCCGCTGTGGACTCCAGCCACCAGCAGCAACATTCCCCTCAGAATGTG

CATCCCGAGGGGCCGGTTTCACCATTCACCCCAGAATTCCTGGTCCAGCGGCACTGGCGAGCTATGGAGGATACCTGTTTTGAGATCCAGAGTCCCTCAT

GTACAGATTCACAAAGCCAAATCCTGGAGTACATTCATAAAATAGAGGCTGACCTGGAACACTTAAAG AAGGTGGAGGAAAGTTACGCTCTTCTTTGCC

AAAGGCTGGCTGGCTCAGCCCTCCCCGACAAGCTCTCAG - UNI28303 - ATAAAAGTTAGAGCCCCGTGTCCTGGAGGTGACTGCAGCTTGTTGGA

TTTTGAGTGTCGGCCCTGTATCAACCACATCCTGGCTCCAGTGTGGACACAGAGAGAGTGCGACAGAGGGATCTGCCTGGAACCACCTGGCCTCAGCCAG

GCCCCAGGGGCCCCGCGGGGACTAGTTCTTCCTTCTGGCAGCTGCACACATCTGTCAGTGAGGGAATGCCAGGTCTCTCACGCCTCTCCTCACTATCAGA

AATGCATTTTGATTCAGAGTAAAAACCAAATGTATAGAGCTTTGGGTGTAGGATATAAAATTGTACGTAGGTAAGAAAAAGAGAAAATCAGATGTATTTA

TTTGACTTCATTCCGTATTTGAAAGCACACTTTAATTTTTACTTTGCCTTGTTTTGTTTTTAATTGAGTAGTGAGAGTTTTAGCCCTTTGTATTTAGCAC

ACCCAAGGATCAATTGTTCCTGAAGCCGAGGTCAGGCTGGGGATGGAGAGGTTAGTAGACAGGCAGTGCAGAAGAGCAAAGAGGACTACCTGGCCCTCGC

TAATCTGTAACCCAGCCCTCCTGTCCAGAAGGCTGCCTTTCTGAGGATCATCTCAGAGGTGCTGCATGACTCCTGTGTGTGGATGCCATGAGCTGTGTGT

GCCCGGGTGCTCGGAGCAGGAGGACCTCCTCCCAGCCCAAGGCGAGCATCTCCTACTGGGTTCCATTCCCAGGAAACAGGAATCCTCAGTACACTAAATG

GCAGGCACTTGAAAATGGGTGGATTTCCCTTGTCGTTGTCTTTTCTATTGATAGTTGGGATTTGGGAGAGAAGAAA GAGGTTTTCGAAACTGAATCACT

ACTGAGTTGAACCATGGCTGTCACTAGCCACGGGTACTGCTGATTATAAGGCCAGTAAGAAAATTAGTACCTGGATGTTTGACTCTTAAGGTTTTGCACT

GATGGTGCCAAAGGGCTCTGAGTCACACGCAGAGCCAAGGGAGGGCAGAGGAAGGCATGAAGGAGAGTTGCTCGCATCGCATCCCTTCAGAGAGCTTTCT

CTGACCTCACTGCCATAGCCCTGTCTGTCTGGTGCCAGGACTGGCCTTGGGAACGGGGACCAGCGGTGAGCAGTTGCAGCCGCCAAGGTGCTGACGTGCT

GCAGTGTGGACAGCGCCTGTGGAGGGCCAGCTGGTCAGACTGTGGCCTGACAACTCTTAATTCTGATGGTGTTCAGTGGCTTGCTTTGTGCATTTGATAA

ATATGTTTTTAGAGTGTTCTGTAAAAAAAAAAAATCATTTGTCTAATCTAAATTCTGTTAAGAAGGAGCTCACATGTTGCTTACATCTTGCAGGAGGGGG

CCTCTGAACTCTGGGGGCAGTCAGGATGTAATTTTATTCTCCCCTTAATGCCCCTCACACAAAGGAAGCTCACTGTCGCCAAGAATAGTCCCCCAGCTGC

TTTTATGAACACCTCTACAACTTAACAAGCTCATCTGTCTGGGTCCAGATTCTCGTTTCTGTCCTCTAAGCTCTTACGTCGATTGGCTAGGACCCCTGTA

CCTCATCTATAAATTGGAATCATATTTTGAGTCATAGTCAACCCTAACTCATAATGGAGCTTTGAGATTTTGGAGTAGAATCTAATATATAAGTGAAGTT

TGGGATTTGGACCTCCCTGTATCTCTTAGGAGAAGCAAGTAGAGACCGAATGGTTCCGTTGTCTTCCAGGCAGCCTCTTACACTACACCATCTGGGTAGC

TCATCAGACAGCAGTGTTCCGACCTCAGACACTACAGATCCCTCCGTGGTTCTCCAGCACAGTTCAGCCGGAACTCTGTTCTCCTGCTTGTTTACTTCCC

TCTTTCTGAGTCCCAGCCTCTCAGAGTCACAGCAGGGCTTACTGGACAGGTACTCTGGCGTTGCTCCAGTACTTCCAAATAAATGCATATCATTACACCT

TCAGATGAAACCTCAGAATGAAGTGCATTCTGAAAGACAACAGCAACAAACCACTTTGTAAGTTTTTTTTTTACTCTACCAGCCTTACTTCTTGCCTGTT

CCCCTCCCTCGGGCCTCCTGTGCCTTCCACTCCATTCTGGCCATTAGAATCCATTTGACTTTGACATTACATCTCCCTTCCGTGGTGGCGACAGCAGTGT

TCCTCCTGTTCTGGAATGAGATGGTCATTGTCATAGTCCTCTTAAAGGTGGGTGACAAGAAGGTGCAGTGTACTTCTGCTCCAAAGAACACTAGGCAAGC

GGAAAGCCATGTGTGCCATGGGTGCAACCTGTGACCCTGCTCTCCTGTGAGCTTAGTGGCTCTCCTGTCACTAACTGGCAGGTTATGTGTGGAGTGTCAC

CTTTTCAGAGAGAAAAACTAACCAAGCCAAACCAGCAAACCCTCCAAGTACTGTAATGTAAAGGCCGGCTTTGGCCTTCCCCACCTGTATAGTTTCATGG

CAGCCCCCTGGACTGTTGAGTTCTGCTGCTTTCACAACCTAAACTGTAACTATTTATTGTATCACACGCAGGTTGTTCATGAGTATTTTTTCCTTTGTTT

CCCCAAACAACTTCTTTTTTTTTTTTTAAGTCTTGGAAGCTTATGGTTTATTGTGGATTGCTCTCAGGAGAGTAAGAGACAAGAAAAGCAACATATATGT

GGGGGGAGGGGTTGGAGTGGTGGTGGAGCAAAGCCAGCTGGAGACAGGCTCCAGCCTAGACCCTTGAAGACCAGAGAGCAGCAATGCACCATACTCTTGA

TTTCATGGGGAGAAAGGGGGATGGACCCCCAGGCCAGGAGGTGTAACTCCTAGCTGCACCTGTTTCCATATGACCAAGAGTAATCATCCGGGAATGAGAG

AGTCTATAAAGAACACTCATTGCTGCTGCAGGTGAGCCAGACATGGCCAGGTGACACCAGCCATGTCTCTGATTTCAGTCAACTCTTTTCATTTGTTTCC

TGAATAGCAAACACTTCCTTGAAACTCTTCTCAAACTTGGACTCCAGTCTAAGTCCCATTTCGCCAAACTTAGGGTCCTTGAACGTGATTTTGTGATTCC

GGAAGATGAGCCTCATGTCTTGCACAAAGTCTTCTACTTGGCAGTAAGCCTGGTCACTCAGCTTTTTCTTGATTATGTTCAACCACATAGGCTCTTGCAC

ACCCACAGTCATCTCTCTAAAATAATAATAATATGGCATCTTGGAAAAAAAGGAGCTCTCAGAACAGCAATAGACTCTCAAGAGAACATACTCGCACTTC

AACTGTTCCTGGGGAGCCATCTCCCTCTGCAGTATCTCAGATTCTGGAAGACTCGGTTGACTTCCTAAGGACTGCATCCTACAGAAGATGCAACTCCATG

GTGTTATCTCAGCTTCCACTGTTGGGATATGACAGTCCTCATGGAAGGCTCTGGAACAAGTATCACAGCAGAAGAGTATTCCTCCATCCCGGCACACCTC

ACATTCATCTGAGTTCTGAATACTAGGGTCAGCTGGGGAACGATGCAAGTTCTGTGTTCTCTGCTCTTTTCTTTTGCGATGTATCCGTGGAGGATTGGGT

AGAAATTTTCTCTGGATCAGGAGTTTGAGGGGCCAATTATGGCAGCGCAGGCTCAGTTTCCAGTTCTTTGACTTTCCATAGCCTCCCATCATTTCAAATT

CCGAGGGTGTGAACCAGTTTCCATTCTGACACTGTATGGACTTCACAGATATCCCTTGTTTGAATTTATCCTTGTGTAACACTCCCTTCAAGTTACCACA

CGTCACGGGAAGCAACTCAGCACTAAAATCGGCATTTTCTTTTCTGCGTCTTCTTAGACCCCTGATCTTAGCAGTGCGTCCTGGGTTCTTTTTCATTTTC

TTTCTCTTGAAAGCTGCCTGGACAACAGCTATTCTGCCACGTTTTCTCTGTACACTCATTGGCTTTCTCCATTTTGGTTTTGACCAGTTGTGGCCTTTCT

TTTTTCTTCTCTGCTTCTTGGGTTTTCTTGCAGGAATGTTCCTCCTGGTGCCCACACATTCTCCTTGGCTGCTTCCCATCCTTGCTTCCAGGTCTTCTGG

CACATATGTTGGGGAACACATGACACAGGAACACTTCTTTTCACGTGTGGGTTGCTGTGCTCCTGGGCCAAAATTGTGGGTGTACATAGGTTTGTTATCT

AATTTTGTAATACTGGGGACCAAGCTCAGGGTCTCATTTGTGCAAGGCAAGCAGTCTACCAGTGCCCCAAACAACTTCTAATGACCTCTAGAAAGAACAA

GCCCTTTTTTAGAAAGTATTTTGTTTCATTGTCTTTTGGGGAGTGAAGAAGAGAAAAGTCCTTGTTGCCAGAATTTTAGAAGCTAAAAGACTTTATGCTG

CCTCTACTGCAGGGGCTCGTTTTCCCGTCGCTCCTGGGCACTGGCGCTGGCCTGCTGCCTGCAGCTGGTACCCTGCCCAAGCTGTCTTCTCTGCAGCCGC

CTGCTTGAGCTTGCTCTGTGCCTGCTTCCCTCCACGCTCCGAAAACCATGATCTACAAAAACAGACTTCTGCAAGGTCTCGCTCGCCTGCCCACCCGCCC

CCTAACGTTGTGTTGGTTTTGGTTTTTGTTTTTGTTTTTGACAGTTCACCCCCATTTAGTGTGAGCTGTAAAACTGTACTTTATTTAAAGGCGTGCTCTT

GTTCCCGTCTGGCTGCCTTCCCCATGGGTGCTGAGGGTTTGGGTAATACACTGATCAGGAAAAGGTGGTCTTCTCAGAAACCAGTCCCTCCCTCCCAGCC

ATTGCCAGGTGCCACCCGCTAAGCAGACATACTACAGCAGGGGACCGTAGCGTGCACACTGTTGGTGGTTTTTAATGAGCCTCTCTTTCCCCACTAGGCT

GTCTCACTTTACTTGTTCACCATACAATCATTTACTCTTTAACAAAAATTGCTTTTAAGAGAAATCTGGAACTATCTTTAAAAAAAAAACCTTATTAATA

ATCATGTATTTTTACTGATCACATTTTGAAATGCCTAAAAGACTTTTATTGCTCTAATTATCCAGATGCACCTTTGTAAAAAGCTCTTTTATGAATTAGC

TGATAAGGCTGTATGTTTCTGGAACAAAATATTGGGTCATCTAAAACTTTCTGTTTTCTGGGGTCTGGGAAAATAGAAAATAAGAATTCAAATATTAAAT

AAGCTTAAAAGAACTG
Translation
MSGTQSTITDR - UNI14673 - RFPLKKPIR - UNI14673 - - UNI18745 - RHGSILNRESPTDKKQKVERSSSHDFDPTD DSSSKKTK

SSSEESRSEIYG - UNI19528 - GLVQRCVIIQKDDNGFGLTVSGDNPVFVQSVKED - UNI23289 - DGAAMRAGVQTGDRIIK VNGTLVTH

SNHLEVVKLIRS SGSYVALTVQGRPPGSPQIPLADSEVEPSVTGHMSPIMTSPHSPGAAGNMERITSPVLVG EENNVVHNQKVEILRKMLQKEQERLQ

 LLQEDYNRTATQRLLKEIQEAKKHIPQLQEQLSKATGSAQ DGAVIAPSRPLGDALTLSEAEADPGDGLCRTDWSSGDASRPSSDSAD SPKSSLRERS

YLEEAPERSEGVQDA QEPQSLVGSPSTRGAPHIIGAEDDDFGTEHEQ INGQCSCFQSIELLKSRPAHLAVFLHHVVSQFDPATL LCYLYSDLYKQTN

SKETRRVFLEFHQFFLDRSA HLKVPVPEEISVDLE EKRRPELIPEDLHRLYIQTMQERVHPEVQRHLEDFR RQKRSMGLTLAESELTKLDAERDKDR

GTLEKERACAEQIVTKIEEVL LMTAQAVEEERS SSTMQYVILMYMKYLGVKVKEPRNLEHKRGRIGFLPKIK QSMKKDREGEEKGKRRGFPSILGPP

RRPSRHDNSAI IGRAMEIQKSRHPKHLSTPSSVSPEPQDPAKLRQSGVANEGTDTGYLPASSMSSATSGTALSQEGGRENDTG - UNI297 - GTKQ

VGEASAPGDCLDSTPRVPTTVFDFPPPLLDQVQEEECEVER RVAEHGTPKPFRK KFDSIAFGESQSEDEQFENDLETDPPNWQQLVSREVLLGLKPSE

IKRQEVINE ELFYTERAHVRTLKVLDQVFYQRVSREGILSPSELRKIFSNLEDILQLHV VGLNEQMKAVRKRNETSVIDHIGEDLLIW - UNI5773

 - FSGPGEEKLKHAAATFCSNQPFALEMIKSRQKKDSRFHTFVQ DAESNPLCRRLQLKDIIPTQMQRLTKYPLLLDNIAKYTE - UNI5626 - EW

PPEREKVKKAADHCRQILNYVNQAVREAENKQ RLEDYQRRLDTSNLKLSEYPNVDELR NLDLTKRKMIHEGPLVWKVNRDKSID DLYTLLLEDILVL

LQKQDDRLVLRCHSKILASTADSKHTFSPVIKLSTVLVRQVATD DNKALFVISMSDNGAQIYELVAQTVSEKTV VWQDLICRMAASVKEQSTKPIPLP

QPPPCE EGDNDEEEPAKLKVEHHDLSVAGLQSPD DRVLGLESPLISSKPQSHSLNTPGKSAAEHLFVTATQFAKEQHANGALKEGDGGYPVTIPGPHL

PVSEERWALDALRNL LGLLKQLLVQQLGLTEKSTQEDWQSFSRYGPASEEVQADSGIRDLENVKACHAREGQMSFKTGTGDIATCDSPRTSTESCAAQD

SVILASQDSQASNVLVMDHMILTPEMPPAEPEGGLDESGEHFFDAREAHSDDNPSEGDGAVKKEEKDVNLRISG GNCLILDGYDAVQESSTDEEVASSF

PLQPVTGIPAVDSSHQQQHSPQNVHPEGPVSPFTPEFLVQRHWRAMEDTCFEIQSPSCTDSQSQILEYIHKIEADLEHLK KVEESYALLCQRLAGSALP

DKLSD - UNI28303 - DKS 

For any suggestions or comments, please send an email to unitrap@crg.es