Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000059834 (Sclt1)
Chromosomal location
Chr 3: 41430627 - 41546436 (-)
Description
sodium channel and clathrin linker 1 Gene [Source:MGI Symbol;Acc:MGI:1914411]
RefSeq_dna
NM_001081411 
RefSeq_peptide
NP_001074880.1 
UniGene
Mm.331001 
MGI
MGI:1914411 
Uniprot/SPTREMBL
Q6PAJ0 Q8BZ15 Q8C1J1 Q8R0R3 Q9CSV4 Q9CUR9 
Human Ortholog
ENSG00000151466 (SCLT1)
Omim not available
UniTrap UNI25538
Vector Insertion
Chr 3: 41538158 - 41545916
Public Clones not available
Private Clones OST178376 (lexicon)
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38230
Vector Insertion
Chr 3: 41507307 - 41513457
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 30% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27289
Vector Insertion
Chr 3: 41486295 - 41507307
Public Clones IST12265H5 (tigm) IST12685E12 (tigm) IST12265H6 (tigm) IST12122B4 (tigm)
IST12321B5 (tigm) IST12550A10 (tigm)
Private Clones OST64939 (lexicon)
Severity of mutation (?) Insertion after 33% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35079
Vector Insertion
Chr 3: 41451366 - 41461319
Public Clones IST11717A11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 79% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000026866
Sequence
TCCAAGGAACGGTCTGGGGCACCGCTTTCAAAGTCGCAGGGCGGGCCGAGTGGACTCCGCGGCCGCTCCTGCTTTCCCGCGGCCCTGGCGTCGCCCCTCA

GCCGGCGGGGACGCTGCCGCCCAGCCAGGCGCGTCGCAGGGTCATCCTCCCGCGCGGTCTGACGGGAACTCGGCGCCCTCCGGCCGCGCGCGGCTCCGCG

GCCCTTCTCGTCCGGCCGGGTCCGGCCGAGCGCGGAACGGAGTCTGAGGCGCGTCGCCTGGGTTCCGCGGAGCGGCGGGCCGGGCTGCGCCGCCGCGTGA

GTGGGATGCTGATGTCTCCGCGCCAGGGCTCGGCTGCCCCTGCGACCCCTTAGCTTTTTGTTTGCCCTCACAGCGGGAGGCTGCTTTTTTGTTGTTGTTC

GATTGCTTGCTTGTTTGAGAAATACCTTCTTTCCCCCCTGCGAGGAATCGATAAACGTGATGAAAACTCCAAACTAAAATATCGAAATGGCCACAGAAAT

CGACTTACTGAGAGACCAAA - UNI25538 - AAGATAAACTAAATGATATTCTTAGGCAGCATCAAATCGAACATATTTTCAGAGACCCAACTATGC

AG AACAGCATGTCCAAAGGAGGCAGAGGTGACACACTAGTAGACTCAATAAATGAGCAAAG TTCTTTACCTCCTCTCATTGCTGAGTATGAGAAACAT

CTGGAAGAGCTAAACAGGCAGCTGACCTATTACCAG AAGCACATGGGTGAGATGAAACTACAACTTGAAACTGTCATCACAGAAAATGAAAG GTTGCA

CAGTAAATTAAAAGATGCTGTTGAAAAGCAATTGGAAGCCCTTCCCTTTGGCACAGGGATAGGAAATGACATCTGTGCAGATGATGAGACCGTGAGGATC

CTTCAAGAACAATTGCAACTAGCCAATCAA GAGAAAACTTGGGCTCTGGAACTCTGGCAGACTGCTTCTCAGGAGTTGCAAAGTGTACAGAAACTCTAT

CAGGAGCATATGACTGAAGCCCAGATTCATGAATTTGAAAACCGAAAGCAAAAA GATCAGCTGAACAATTTTCAACAACTAACCAAGAAACTCCATGTT

GCTAATGAGAACATAGAAATG ACTAACCACCACTTCCTGAAAACAGTAACTGAACAAAACATGGAGATTGAGAAACTTCGAAAACATCTTAG - UNI2

7289 - GCAAGCCAGATTAGATCTGAGAGTTGCAGTATCGAAAGTGGAAGAGTTAACTAAAGTGACTGAAGGTCTTCAAGAGCAGATGCTGAAGAAG G

AGGAAGATATTATGTCTGCACAAGGAAAAGAAGAAGCGTCGGATAGACGAGTACAGCAGTTACAATCTAGTATAAAACAGTTAGAGTCAAG ATTGTGTG

TAGCAATTGAAGAAGCCGATGTACTAAAAACAGGGAAATCAAATTTGGAAAAGCAAATCAAAGAACTACAAGCAAAATGTAGTGAATCAGAAAATGAGAA

ATATGAGGCTATTTCAAGAGCCAGAGATAGCATGCAGCTCTTAGAAGAAGCTAACATTAAACAAAATCAG ATTCTCCTTGAAGAGAAACAAAAAGAGGT

TGACAGAGAAAAAATGAAGAAAACAATGTCTCAGCTTATACAAGATGCAGCTATCAAAGCAAGGAAAGAG GTTGAAAGCACAAAAAAACAATATGAAAT

TCTGATTTCACAATTAAAGGAAGAACTCTCAACCCTTCAAATG GACTGTGATGAAAAGCAAGGTCAAATTGATCGAGCCATTAGAGGGAAAAGAGCCGT

GGAAGAAGAACTGGAGAAG ATTTACCGTGAAGGCAAACAGGATGAAAGTGATTACAGAAAATTGGAAGAAATGCATCAAAGATGTCTTGCTGCAGAACG

TTCAAAAGATGATCTTCAGCTAAGACTCAAGAGTGCAGAAAATAGAATAAAACAACTTGAAATTAA - UNI35079 - TTCCTCAGAAGAGATGTCAC

GTTCCCATGAAATGATCCAGAAACTTCAAACTGTATTGGAGTCAGAGAGGGAGAACTGTGGCTTTGTCAGCGAGCAGAGGCTGAAGCTTCAGCAGGAAAA

CGAGCAACTACAGAAGGAGACCGAGGATCTCAGAAAAGTTGCTCTGGAGGCCCAAAAAAAAGCAAAATTAAAG - UNI35079 - GTCAGTACAATGG

AGCATCAGTTCTCAATTAAGGAGCATGGGTTTGAAGTTCAGCTGAGAGAAATGGAGGACAGTAATCGGAATTCCATTGTTGAACTGAGGCATCTTTTGGC

AGCTCAACAAAAGACAGCCAATAGGTGGAAAGAAGAAACCAAGAAACTTACTGAAAGTGCAGAAATGAGGATCAGCAGTCTAAA - UNI35079 - GA

GTGAGCTGAGCCGACAGAAGCTTCATACCCAGGAGCTACTTTCTCAACTGGAAATGGCAAATGAAAAGGTGGCTGAG AATGAAAAGTTAATTCTGGAAC

ATCAAGAAAAAGCAAACAGACTTCAAAGGCGTCTAAGTCAGGCAGAAGAGAGAGCTGCTTCAGCGTCCCAGCAG CTCAGTGTGATTACAGTGCAGAGAA

GAAAAGCAGCTTCCATGATGAATCTGGAAAATATTTAAACATATTCATAGTTCACTGACAGAACTGTAGAGTTGGGAAAGCTGTTGTACCAAACGTATTG

ACATGGAGAAGCCTGCTGAGAATGGGGAAGGCTTGTGTCATTTTGCATAAGCATTTTCCATTCTGTTTTGAGGGTTATTGGAAAACAGAACAGTGACAGC

TTCTTGTAAGTAGAAAACTATAATCCTATATTTGAGATTCAGTAGAGAATAAAGCCAGCTGAGAAGAACTCACTGCCTTCATCAATGTCTATTTTTAATT

CCTTTTTCCCCCTCCTTGGAAGAACATAATATTTTCAAGAGGTTTAATTAAATCCCTAGAATTTGATATTTCAGGTTCTAAGATTTGGAGATTTAATGTC

TCATTTTTTACTCTTAATTCATTTTTATAATTCTTAAGATTCTATTTTACTATGAATTCATAAATGTAATAAATTATGTATTTTGTAAAATTATGTTGTC

ATGTA
Translation
MATEIDLLRDQK - UNI25538 - KDKLNDILRQHQIEHIFRDPTMQ NSMSKGGRGDTLVDSINEQS SSLPPLIAEYEKHLEELNRQLTYYQ KHM

GEMKLQLETVITENER RLHSKLKDAVEKQLEALPFGTGIGNDICADDETVRILQEQLQLANQ EKTWALELWQTASQELQSVQKLYQEHMTEAQIHEFE

NRKQK DQLNNFQQLTKKLHVANENIEM TNHHFLKTVTEQNMEIEKLRKHLR - UNI27289 - RQARLDLRVAVSKVEELTKVTEGLQEQMLKK E

EDIMSAQGKEEASDRRVQQLQSSIKQLESR RLCVAIEEADVLKTGKSNLEKQIKELQAKCSESENEKYEAISRARDSMQLLEEANIKQNQ ILLEEKQK

EVDREKMKKTMSQLIQDAAIKARKE VESTKKQYEILISQLKEELSTLQM DCDEKQGQIDRAIRGKRAVEEELEK IYREGKQDESDYRKLEEMHQRCL

AAERSKDDLQLRLKSAENRIKQLEIN - UNI35079 - NSSEEMSRSHEMIQKLQTVLESERENCGFVSEQRLKLQQENEQLQKETEDLRKVALEAQK

KAKLK - UNI35079 - VSTMEHQFSIKEHGFEVQLREMEDSNRNSIVELRHLLAAQQKTANRWKEETKKLTESAEMRISSLK - UNI35079 - K

SELSRQKLHTQELLSQLEMANEKVAE NEKLILEHQEKANRLQRRLSQAEERAASASQQ LSVITVQRRKAASMMNLENI

For any suggestions or comments, please send an email to unitrap@crg.es