Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000059842 (Zfp341)
Chromosomal location
Chr 2: 154439104 - 154472552 (+)
Description
zinc finger protein 341 Gene [Source:MGI (curated);Acc:Zfp341-001]
RefSeq_dna
NM_199304 
RefSeq_peptide
NP_955008.2 
MGI
MGI:2682937 
Uniprot/SPTREMBL
Q6PGC9 A2AVM0 
Human Ortholog
ENSG00000131061 (ZNF341)
Omim not available
UniTrap UNI9727
Vector Insertion
Chr 2: 154439105 - 154439139
Public Clones XG096 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30139
Vector Insertion
Chr 2: 154439139 - 154447488
Public Clones D105B01 (ggtc) IST10910B5 (tigm) IST13017A3 (tigm) IST11763H8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 1% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7206
Vector Insertion
Chr 2: 154450788 - 154452513
Public Clones RRU544 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3646
Vector Insertion
Chr 2: 154458206 - 154459822
Public Clones XT0209 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 48% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000081926
Sequence
CAAGATGGCGCAGGCGATCTTCGAGGCCCTGGAGG - UNI9727 - - UNI30139 - GAATGGACAATCAAACGGTTCTGGCCGTCCAGTCCTTAC

TGGATGGCCAAGGAGCAGTCCCTGACCCCACAGGACAAAGTGTAAATGCGCCACCTGCCATCCAGCCACTGG ATGACGAGGATGTCTTTCTCTGCGGGA

AGTGTAAAAAGCAGTTCAACTCACTGCCAGCCTTCATGACCCACAAGCGTGAACAGTGCCAGGCAAACGCCCCTGCCCTGGCCACAGTCTCGCTGGCTAC

CAACAGCATCTATACACCGTCAGCAGCACCCGCTGCCGTCCAGCAGGCCCCACCTCCTGCCAACCGCCAG - UNI7206 - ATCTCCACGTACATCAC

AGTGCCCCCCTCCCCACTGATCCAGACCCTGGTGCAAGGGAACATCTTGGTGAGCGATGATGTGCTTATGTCTGCCATGTCTGCCTTCACATCCCTGGAC

CAGCCAATGCCTCCAGGGCCCCCACCTGTGCAG AACAGCTTGAACATGCATCCTGTGCCCAATTACCTCACCCAGCCTCCACCCCCTCCTCCACCCCCT

CCGCCTCTCCCCCCACCCCCCCAGCCTCCTCCTCCCCCACCCCAGACTCTGGGCCCTTCTGGGCGCTCCAACCCTGTTGGGAACAGTGTGGTGGAGGTGT

ACAATGCTGCTGCTCCCATGGCTGGGAACGGAACGGTGGAGATCCAGGCGCTGGGGATGCAGCCGTACCCGCCCCTGGAG GTACCAAGCCAGTGTGTGG

AGGCTCCAGTGTACCCCACTCCCCCAGTGTACAGCCCTGGCAAGCAGGAATTCAAACCCAAAGGACCCAGTTCCACTGCCCCCATGACCAATGCAACTGG

GAGCACGGTGGCCACCTTTGACTCCCCACCAACGTTGAAGACCAGACGTGCTAAAGGTGCCAGTGGACTCCCAGAAG CTGCAGGGAAGCCAAAAGCTCA

GAAACTCAAGTGCTCCTACTGTGACAAGTCCTTCACCAAGAACTTTGATCTTCAGCAGCATATCCGAAG CCACACAGGGGAGAAGCCCTTCCAGTGCAT

TGCGTGTGGCCGTGCCTTTGCCCAGAAGTCTAACGTCAAGAAGCACATGCAGACTCATAAGGTGTGGCCTCCAGGGCGAAGTGGCGGCACAGTCTCCCGA

AACTCTGTGACCGTACAAGTCATGGCTTTGAACCCCAACAGGCAGGAAGAAGAAGACACGG - UNI3646 - GGTTGGGTCAGTCACTGTCCAGTACC

ACACAGCCCCAGGCCTTGCCCACGGCAGGTGAGGATGAAGGTGACAAGCCAGAGGCCAAGCAGGTGGTCCTGATCGACAGCTCTTACCTGTGTCAGTTCT

GCCCCAGCAAGTTCAGCACCTACTTCCAGCTCAAGTCCCACATGATTCAGCACAAGAAGGAGCAG GTGTACAAGTGCGTGGTCAAAAGCTGTGCCCAGA

TGTTCCCCAAGCTGGACACCTTTCTGGAGCACATCAGAAGCCACCAGGAGGAGCTGAGCTATCGCTGCCATCTCTGTAGCAAGGACTTCCCCTCACTGTA

TGACCTGGGCGTACACCAGTACTCCCACAGCCTCCTGCCGCAGCACAGCCCCAAGAAGGACAGCACCGTCTACAA GTGTGTCAAGTGTGTCAACAAATA

CTCCACTCCCGAGGCCTTGGAGCACCACGTGCAGACGGCCACTCATAGCTTCCCCTGCCCGCACTGCCAGAAG GTCTTCCCCTGTGAACGCTACCTGCG

GCGTCACTTACCCACCCATGGCAGTGGTGGCCGATTCAGGTGCCAGATCTGTAAGAAGTTCTTCCGGAAGGAGCACTACCTCAAGCTACACGCCCACATC

CACTCAG GTGAGAAGCCCTACAAATGCTCAGTGTGTGAGTCTGCCTTCAACCGCAAAGACAAGCTGAAGAGACACATGCTGATCCACGAGCCCTTCAAG

AAATACAAATGCCCCTTCTC GATGCACACGGGCTGCAGCAAGGAGTTCAACCGGCAGGACAAGCTGAAAGCCCATATCCTCTCCCACGCTG GCCTGAA

GCTCCACAAGTGTGGGCTGTGCAGCAAGTCCTTCAGCCGTCGAGCTCACCTGGCAGAGCACCAACGAGCCCACACAGGCAACTACAAGTTCCGCTGCGCG

GGCTGCGCCAAGGGCTTCTCACGACACAAATACCTCAAGGATCACCGCTGCCGCCTGGGCCCCACCAAGGACAAGGACCTGCAAGCCCGGCGGCCTCCCC

GGAGGAGGGCAACGGCGCGTGGTGGTGGCAGCATCGCCAGCGGGCACAAGGAGGAGAACCCCATGCCAGACCCGCTGGGGCTGGAGGAGCTGAAGGCCGC

AGGACCCTCGCCTGAGGCTGCCCCTGGCAAGCCACCCTTTGAGCAGGACGCTGTGTTGTCCATTGTGGTGGGCGGGGACCCGGAGCTGGTGGTGCCTGGG

CACACAGAGGGTCTGGGCTCCAACCTGGCACTTGCCGAGCTGCAGGCTGGAACCGAGGGAGGGTGTGCCATGCTCGCCGTCCCAGTCTATATCCAAGCCT

CAGAGTAACCAGGCTAGACTTCCCGGAGGTGTGTGTGTTGGGGGCGGGGAGGGTGCACTAGCACAATCCCTTTTGGAAGTTACTGTATCAGCCTTGCCCC

ACCGCTGTTCTTCCATGCCCCGAGATTATCTGGGGAAACCTGTAGCACTCACAGGGTCTGAGGCAGGCACCATAGCTCCAGGGCATAGCAGCGGTAAGAG

AGATGGCCAGAGCATGAAGTGCTCAGGGCCTAGCTGATGGAGGCTGGTACTTGGGCATCCTTTAAGACACGGTAGGGTGGCCCCACCCACCTATCCAGGT

TACCTGGGGTGGCCTCAGGTTGTGCTGCTCTTCAGGATGCTAGCTGGATGTGGCTGGAGTCCTTGTGTGTTAAACACTTCTTGATGAGGGATTCCTCAGA

CGACTGTATGAGGTGAGCATGTAAGAGGCACTTATCCTGGGGCGTAGACTATAGCTGCCAGCCAGCCCTTGCTTCAGATTCACCACTGTGACCTGAGCAA

GCACATCACCTCTCTCTGTTCCACGTTCCTCACCTGTGCAACAGGACTTCGTATAGCACTACCTCCTAGAGTGTTCCGAGGACATAGTATACGAAAATGT

GCAAAGGACTGGGCACAGTACCCATGGCCTGGCAAGTGCTCAATAAATCTCAATAAATGTTTTTACCAACCTCATGGGTCCAAACC
Translation
MAQAIFEALEG - UNI9727 - - UNI30139 - GMDNQTVLAVQSLLDGQGAVPDPTGQSVNAPPAIQPLD DDEDVFLCGKCKKQFNSLPAFMTH

KREQCQANAPALATVSLATNSIYTPSAAPAAVQQAPPPANRQ - UNI7206 - ISTYITVPPSPLIQTLVQGNILVSDDVLMSAMSAFTSLDQPMPPG

PPPVQ NSLNMHPVPNYLTQPPPPPPPPPPLPPPPQPPPPPPQTLGPSGRSNPVGNSVVEVYNAAAPMAGNGTVEIQALGMQPYPPLE VPSQCVEAPVY

PTPPVYSPGKQEFKPKGPSSTAPMTNATGSTVATFDSPPTLKTRRAKGASGLPEA AAGKPKAQKLKCSYCDKSFTKNFDLQQHIRS SHTGEKPFQCIA

CGRAFAQKSNVKKHMQTHKVWPPGRSGGTVSRNSVTVQVMALNPNRQEEEDTG - UNI3646 - GLGQSLSSTTQPQALPTAGEDEGDKPEAKQVVLI

DSSYLCQFCPSKFSTYFQLKSHMIQHKKEQ VYKCVVKSCAQMFPKLDTFLEHIRSHQEELSYRCHLCSKDFPSLYDLGVHQYSHSLLPQHSPKKDSTVY

K KCVKCVNKYSTPEALEHHVQTATHSFPCPHCQK VFPCERYLRRHLPTHGSGGRFRCQICKKFFRKEHYLKLHAHIHSG GEKPYKCSVCESAFNRKD

KLKRHMLIHEPFKKYKCPFS SMHTGCSKEFNRQDKLKAHILSHAG GLKLHKCGLCSKSFSRRAHLAEHQRAHTGNYKFRCAGCAKGFSRHKYLKDHRC

RLGPTKDKDLQARRPPRRRATARGGGSIASGHKEENPMPDPLGLEELKAAGPSPEAAPGKPPFEQDAVLSIVVGGDPELVVPGHTEGLGSNLALAELQAG

TEGGCAMLAVPVYIQASE
Transcript ENSMUST00000109702
Sequence
AGATGGCGCAGGCGATCTTCGAGGCCCTGGAGG - UNI9727 - - UNI30139 - GAATGGACAATCAAACGGTTCTGGCCGTCCAGTCCTTACTG

GATGGCCAAGGAGCAGTCCCTGACCCCACAGGACAAAGTGTAAATGCGCCACCTGCCATCCAGCCACTGG ATGACGAGGATGTCTTTCTCTGCGGGAAG

TGTAAAAAGCAGTTCAACTCACTGCCAGCCTTCATGACCCACAAGCGTGAACAGTGCCAGGCAAACGCCCCTGCCCTGGCCACAGTCTCGCTGGCTACCA

ACAGCATCTATACACCGTCAGCAGCACCCGCTGCCGTCCAGCAGGCCCCACCTCCTGCCAACCGCCAG - UNI7206 - ATCTCCACGTACATCACAG

TGCCCCCCTCCCCACTGATCCAGACCCTGGTGCAAGGGAACATCTTGGTGAGCGATGATGTGCTTATGTCTGCCATGTCTGCCTTCACATCCCTGGACCA

GCCAATGCCTCCAGGGCCCCCACCTGTGCAG AACAGCTTGAACATGCATCCTGTGCCCAATTACCTCACCCAGCCTCCACCCCCTCCTCCACCCCCTCC

GCCTCTCCCCCCACCCCCCCAGCCTCCTCCTCCCCCACCCCAGACTCTGGGCCCTTCTGGGCGCTCCAACCCTGTTGGGAACAGTGTGGTGGAGGTGTAC

AATGCTGCTGCTCCCATGGCTGGGAACGGAACGGTGGAGATCCAGGCGCTGGGGATGCAGCCGTACCCGCCCCTGGAG GTACCAAGCCAGTGTGTGGAG

GCTCCAGTGTACCCCACTCCCCCAGTGTACAGCCCTGGCAAGCAGGAATTCAAACCCAAAGGACCCAGTTCCACTGCCCCCATGACCAATGCAACTGGGA

GCACGGTGGCCACCTTTGACTCCCCACCAACGTTGAAGACCAGACGTGCTAAAG CTGCAGGGAAGCCAAAAGCTCAGAAACTCAAGTGCTCCTACTGTG

ACAAGTCCTTCACCAAGAACTTTGATCTTCAGCAGCATATCCGAAG CCACACAGGGGAGAAGCCCTTCCAGTGCATTGCGTGTGGCCGTGCCTTTGCCC

AGAAGTCTAACGTCAAGAAGCACATGCAGACTCATAAGGTGTGGCCTCCAGGGCGAAGTGGCGGCACAGTCTCCCGAAACTCTGTGACCGTACAAGTCAT

GGCTTTGAACCCCAACAGGCAGGAAGAAGAAGACACGG - UNI3646 - GGTTGGGTCAGTCACTGTCCAGTACCACACAGCCCCAGGCCTTGCCCAC

GGCAGGTGAGGATGAAGGTGACAAGCCAGAGGCCAAGCAGGTGGTCCTGATCGACAGCTCTTACCTGTGTCAGTTCTGCCCCAGCAAGTTCAGCACCTAC

TTCCAGCTCAAGTCCCACATGATTCAGCACAAGAAGGAGCAG GTGTACAAGTGCGTGGTCAAAAGCTGTGCCCAGATGTTCCCCAAGCTGGACACCTTT

CTGGAGCACATCAGAAGCCACCAGGAGGAGCTGAGCTATCGCTGCCATCTCTGTAGCAAGGACTTCCCCTCACTGTATGACCTGGGCGTACACCAGTACT

CCCACAGCCTCCTGCCGCAGCACAGCCCCAAGAAGGACAGCACCGTCTACAA GTGTGTCAAGTGTGTCAACAAATACTCCACTCCCGAGGCCTTGGAGC

ACCACGTGCAGACGGCCACTCATAGCTTCCCCTGCCCGCACTGCCAGAAG GTCTTCCCCTGTGAACGCTACCTGCGGCGTCACTTACCCACCCATGGCA

GTGGTGGCCGATTCAGGTGCCAGATCTGTAAGAAGTTCTTCCGGAAGGAGCACTACCTCAAGCTACACGCCCACATCCACTCAG GTGAGAAGCCCTACA

AATGCTCAGTGTGTGAGTCTGCCTTCAACCGCAAAGACAAGCTGAAGAGACACATGCTGATCCACGAGCCCTTCAAGAAATACAAATGCCCCTTCTC GA

TGCACACGGGCTGCAGCAAGGAGTTCAACCGGCAGGACAAGCTGAAAGCCCATATCCTCTCCCACGCTG GCCTGAAGCTCCACAAGTGTGGGCTGTGCA

GCAAGTCCTTCAGCCGTCGAGCTCACCTGGCAGAGCACCAACGAGCCCACACAGGCAACTACAAGTTCCGCTGCGCGGGCTGCGCCAAGGGCTTCTCACG

ACACAAATACCTCAAGGATCACCGCTGCCGCCTGGGCCCCACCAAGGACAAGGACCTGCAAGCCCGGCGGCCTCCCCGGAGGAGGGCAACGGCGCGTGGT

GGTGGCAGCATCGCCAGCGGGCACAAGGAGGAGAACCCCATGCCAGACCCGCTGGGGCTGGAGGAGCTGAAGGCCGCAGGACCCTCGCCTGAGGCTGCCC

CTGGCAAGCCACCCTTTGAGCAGGACGCTGTGTTGTCCATTGTGGTGGGCGGGGACCCGGAGCTGGTGGTGCCTGGGCACACAGAGGGTCTGGGCTCCAA

CCTGGCACTTGCCGAGCTGCAGGCTGGAACCGAGGGAGGGTGTGCCATGCTCGCCGTCCCAGTCTATATCCAAGCCTCAGAGTAACCAGGCTAGACTTCC

CGGAGGTGTGTGTGTTGGGGGCGGGGAGGGTGCACTAGCACAATCCCTTTTGGAAGTTACTGTATCAGCCTTGCCCCACCGCTGTTCTTCCATGCCCCGA

GATTATCTGGGGAAACCTGTAGCACTCACAGGGTCTGAGGCAGGCACCATAGCTCCAGGGCATAGCAGCGGTAAGAGAGATGGCCAGAGCATGAAGTGCT

CAGGGCCTAGCTGATGGAGGCTGGTACTTGGGCATCCTTTAAGACACGGTAGGGTGGCCCCACCCACCTATCCAGGTTACCTGGGGTGGCCTCAGGTTGT

GCTGCTCTTCAGGATGCTAGCTGGATGTGGCTGGAGTCCTTGTGTGTTAAACACTTCTTGATGAGGGATTCCTCAGACGACTGTATGAGGTGAGCATGTA

AGAGGCACTTATCCTGGGGCGTAGACTATAGCTGCCAGCCAGCCCTTGCTTCAGATTCACCACTGTGACCTGAGCAAGCACATCACCTCTCTCTGTTCCA

CGTTCCTCACCTGTGCAACAGGACTTCGTATAGCACTACCTCCTAGAGTGTTCCGAGGACATAGTATACGAAAATGTGCAAAGGACTGGGCACAGTACCC

ATGGCCTGGCAAGTGCTCAATAAAT
Translation
MAQAIFEALEG - UNI9727 - - UNI30139 - GMDNQTVLAVQSLLDGQGAVPDPTGQSVNAPPAIQPLD DDEDVFLCGKCKKQFNSLPAFMTH

KREQCQANAPALATVSLATNSIYTPSAAPAAVQQAPPPANRQ - UNI7206 - ISTYITVPPSPLIQTLVQGNILVSDDVLMSAMSAFTSLDQPMPPG

PPPVQ NSLNMHPVPNYLTQPPPPPPPPPPLPPPPQPPPPPPQTLGPSGRSNPVGNSVVEVYNAAAPMAGNGTVEIQALGMQPYPPLE VPSQCVEAPVY

PTPPVYSPGKQEFKPKGPSSTAPMTNATGSTVATFDSPPTLKTRRAKA AAGKPKAQKLKCSYCDKSFTKNFDLQQHIRS SHTGEKPFQCIACGRAFAQ

KSNVKKHMQTHKVWPPGRSGGTVSRNSVTVQVMALNPNRQEEEDTG - UNI3646 - GLGQSLSSTTQPQALPTAGEDEGDKPEAKQVVLIDSSYLCQ

FCPSKFSTYFQLKSHMIQHKKEQ VYKCVVKSCAQMFPKLDTFLEHIRSHQEELSYRCHLCSKDFPSLYDLGVHQYSHSLLPQHSPKKDSTVYK KCVKC

VNKYSTPEALEHHVQTATHSFPCPHCQK VFPCERYLRRHLPTHGSGGRFRCQICKKFFRKEHYLKLHAHIHSG GEKPYKCSVCESAFNRKDKLKRHML

IHEPFKKYKCPFS SMHTGCSKEFNRQDKLKAHILSHAG GLKLHKCGLCSKSFSRRAHLAEHQRAHTGNYKFRCAGCAKGFSRHKYLKDHRCRLGPTKD

KDLQARRPPRRRATARGGGSIASGHKEENPMPDPLGLEELKAAGPSPEAAPGKPPFEQDAVLSIVVGGDPELVVPGHTEGLGSNLALAELQAGTEGGCAM

LAVPVYIQASE

For any suggestions or comments, please send an email to unitrap@crg.es