Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000059866 (Tnip2)
Chromosomal location
Chr 5: 34838745 - 34856628 (-)
Description
TNFAIP3 interacting protein 2 Gene [Source:MGI (curated);Acc:Tnip2-002]
RefSeq_dna
NM_139064 
RefSeq_peptide
NP_620703.1 
UniGene
Mm.28615 
MGI
MGI:2386643 
Uniprot/SWISSPROT
Q99JG7 
Uniprot/SPTREMBL
Q80VZ7 
Human Ortholog
ENSG00000168884 (TNIP2)
Omim not available
UniTrap UNI21033
Vector Insertion
Chr 5: 34856267 - 34856588
Public Clones not available
Private Clones OST345252 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114359
Sequence
GAAGTTGGAGACGCCCAAGTCCCCACGGAAGGCCTACAGCCATGTCGTCTGGGGACCCAAGGTCTGGTAGACAGGACGGGGCCCCGCGTGCGGCCGCAGC

GCTCTGTGGCCTGTACCACGAGGCCGGCCAGCAACTACAGCGCCTGAAGGATCAGCTGGCCGCGCGTGACGCCCTCATCGCGAGCCTCCGCACCCGCCTC

GCGGCTCTGGAAGGGCACACGGCGCCGTCACTCGTGGACGCACTTCTGGATCAGGTGGAGCGCTTCCGTGAGCAGCTGCGACGACAGGAGGAAGGCGCTT

CGGAGACCCAGCTGCGGCAG - UNI21033 - GAAGTTGAAAGACTTACGGAGCGTCTAGAGGAAAAAGAGAGGGAGATGCAACAGCTGATGAGCCAG

CCTCAGCATGAGCAAGAGAAGGAGGTAGTCTTGCTTCGGCGAAGTGTGGCAGAGAAGGAGAAAGCCAGGGCCGCCAGTGATGTTCTGTGCCGCTCCTTGG

CTGATGAGACCCACCAACTGCGCAGGACATTGGCAGCCACTGCCCACATGTGCCAACATCTGGCCAAATGTCTGGATGAACGACAGTGTGCACAGGGAGA

CGCTGGGGAGAAAAGCCCTGCTGAG CTAGAGCAAACAAGCAGCGATGCTTCTGGCCAGAGTGTTATTAAGAAGTTACAGGAAGAAAATCGACTGTTAAA

ACAGAAGGTGACTCAT ATTCTTGCTTACAAGGATGACTTCAAATCAGAAAGGGCAGATCGGGAACGAGCGCACAGTAGGATTCAAGAGCTGGAGGAAAA

GATCATGTCCTTGATGTACCAAGTGTCCCAGAGACAG GACTCCCGGGAGCCAGGACCCTGTCGGATTCATACGGGGAACAAAACTGCCAAGTACTTAGA

GATGGATGCACTGGAGCATGTGACCCCTGGCGGCTGGAGGCCTGAGTCTAGGTCCCAACAGATGGAACCTTCTGCAGAGGGTGGGCATGTGTGCACAGCC

CAGAGAGGTCAGGGTGACCTTCAGTGCCCTCATTGCCTGCGGTGCTTCAGTGATGAGCAAGGCGAGGCATTCCTCAGGCACCTGTCTGAGTGCTGCCAAT

GAGCCAGACATTGCCCGTGTGACCCATGACCACCATAGCTGCTCTAAGGGACTGGGAGGGGTCCTCAGACTCAGTTTTCAACTCAGTGTGTTGCATTCTC

CTGGGATCTAGGGCCCAAATGGGCAGGGTCACTGGAAGGTCATCTTGTTTTCATTTGACCATGGTGAGACTTGGTCAGAGGGAACTATTGACAGAGCAGG

AGGAAGAGGTGGGGTCAGGGACATCAAGTGGACATCAGTTTTGTCTCACGTAGAGTTTGGAGTGAGCTGTCAATTCAAAGCTGCAAGCTATCAGTTGTGG

GAATATTCTGAAGCCTGCTTGCACCTAGAGTTATGCCACTTGCTGGAAGGGGAAGTTGCTGTGGGAGCAGTGTGTCCTCTTTCCAGGGTGGTAGCTCCAT

CCTGTTGAGTAGTGAGATACACTCCCTGACTGGTCTGTGCTGCATTACAGTTACATGATACACTAGAACCTTCCCAAACTCAGCAGAGCCACACAGCTGC

ATCCAGTACCATCACCCTGCAAAACACTTGTATTTCCAAAAGGGAAAGCACCTTTATTT
Translation
MSSGDPRSGRQDGAPRAAAALCGLYHEAGQQLQRLKDQLAARDALIASLRTRLAALEGHTAPSLVDALLDQVERFREQLRRQEEGASETQLRQ - UNI2

1033 - EVERLTERLEEKEREMQQLMSQPQHEQEKEVVLLRRSVAEKEKARAASDVLCRSLADETHQLRRTLAATAHMCQHLAKCLDERQCAQGDAGEK

SPAE LEQTSSDASGQSVIKKLQEENRLLKQKVTH ILAYKDDFKSERADRERAHSRIQELEEKIMSLMYQVSQRQ DSREPGPCRIHTGNKTAKYLEMD

ALEHVTPGGWRPESRSQQMEPSAEGGHVCTAQRGQGDLQCPHCLRCFSDEQGEAFLRHLSECCQ
Transcript ENSMUST00000087737
Sequence
AAACGTTCCGGGAAGGCTGGTTTTCGCTCCCCCTGTGTGGAGAAGTTGGAGACGCCCAAGTCCCCACGGAAGGCCTACAGCCATGTCGTCTGGGGACCCA

AGGTCTGGTAGACAGGACGGGGCCCCGCGTGCGGCCGCAGCGCTCTGTGGCCTGTACCACGAGGCCGGCCAGCAACTACAGCGCCTGAAGGATCAGCTGG

CCGCGCGTGACGCCCTCATCGCGAGCCTCCGCACCCGCCTCGCGGCTCTGGAAGGGCACACGGCGCCGTCACTCGTGGACGCACTTCTGGATCAGGTGGA

GCGCTTCCGTGAGCAGCTGCGACGACAGGAGGAAGGCGCTTCGGAGACCCAGCTGCGGCAG - UNI21033 - GAAGTTGAAAGACTTACGGAGCGTC

TAGAGGAAAAAGAGAGGGAGATGCAACAGCTGATGAGCCAGCCTCAGCATGAGCAAGAGAAGGAGGTAGTCTTGCTTCGGCGAAGTGTGGCAGAGAAGGA

GAAAGCCAGGGCCGCCAGTGATGTTCTGTGCCGCTCCTTGGCTGATGAGACCCACCAACTGCGCAGGACATTGGCAGCCACTGCCCACATGTGCCAACAT

CTGGCCAAATGTCTGGATGAACGACAGTGTGCACAGGGAGACGCTGGGGAGAAAAGCCCTGCTGAG CTAGAGCAAACAAGCAGCGATGCTTCTGGCCAG

AGTGTTATTAAGAAGTTACAGGAAGAAAATCGACTGTTAAAACAGAAGGTGACTCAT GTAGAAGACCTCAATGCTAAGTGGCAGCGTTATGATGCAAGT

AGGGACGAATATGTGAAGGGGTTGCATGCCCAGCTAAAGAGGCGGCAGGTCCCTCTGGAGCCTGAGCTGATGAAGAAGGAGATTTCCCGACTTAACAGAC

AGTTGGAGGAGAAAATAAGTGACTGTGCGGAAGCAAACCAGGAGCTGACAGCCATGAGGATGTCCCGGGACACTGCGCTGGAGCGAGTGCAGATGCTAGA

ACAGCAG ATTCTTGCTTACAAGGATGACTTCAAATCAGAAAGGGCAGATCGGGAACGAGCGCACAGTAGGATTCAAGAGCTGGAGGAAAAGATCATGTC

CTTGATGTACCAAGTGTCCCAGAGACAG GACTCCCGGGAGCCAGGACCCTGTCGGATTCATACGGGGAACAAAACTGCCAAGTACTTAGAGATGGATGC

ACTGGAGCATGTGACCCCTGGCGGCTGGAGGCCTGAGTCTAGGTCCCAACAGATGGAACCTTCTGCAGAGGGTGGGCATGTGTGCACAGCCCAGAGAGGT

CAGGGTGACCTTCAGTGCCCTCATTGCCTGCGGTGCTTCAGTGATGAGCAAGGCGAGGCATTCCTCAGGCACCTGTCTGAGTGCTGCCAATGAGCCAGAC

ATTGCCCGTGTGACCCATGACCACCATAGCTGCTCTAAGGGACTGGGAGGGGTCCTCAGACTCAGTTTTCAACTCAGTGTGTTGCATTCTCCTGGGATCT

AGGGCCCAAATGGGCAGGGTCACTGGAAGGTCATCTTGTTTTCATTTGACCATGGTGAGACTTGGTCAGAGGGAACTATTGACAGAGCAGGAGGAAGAGG

TGGGGTCAGGGACATCAAGTGGACATCAGTTTTGTCTCACGTAGAGTTTGGAGTGAGCTGTCAATTCAAAGCTGCAAGCTATCAGTTGTGGGAATATTCT

GAAGCCTGCTTGCACCTAGAGTTATGCCACTTGCTGGAAGGGGAAGTTGCTGTGGGAGCAGTGTGTCCTCTTTCCAGGGTGGTAGCTCCATCCTGTTGAG

TAGTGAGATACACTCCCTGACTGGTCTGTGCTGCATTACAGTTACATGATACACTAGAACCTTCCCAAACTCAGCAGAGCCACACAGCTGCATCCAGTAC

CATCACCCTGCAAAACACTTGTATTTCCAAAAGGGAAAGCACCTTTATTTCCTAATCATTTATTTTTATAATAAATGGCTTTAC
Translation
MSSGDPRSGRQDGAPRAAAALCGLYHEAGQQLQRLKDQLAARDALIASLRTRLAALEGHTAPSLVDALLDQVERFREQLRRQEEGASETQLRQ - UNI2

1033 - EVERLTERLEEKEREMQQLMSQPQHEQEKEVVLLRRSVAEKEKARAASDVLCRSLADETHQLRRTLAATAHMCQHLAKCLDERQCAQGDAGEK

SPAE LEQTSSDASGQSVIKKLQEENRLLKQKVTH VEDLNAKWQRYDASRDEYVKGLHAQLKRRQVPLEPELMKKEISRLNRQLEEKISDCAEANQELT

AMRMSRDTALERVQMLEQQ ILAYKDDFKSERADRERAHSRIQELEEKIMSLMYQVSQRQ DSREPGPCRIHTGNKTAKYLEMDALEHVTPGGWRPESRS

QQMEPSAEGGHVCTAQRGQGDLQCPHCLRCFSDEQGEAFLRHLSECCQ
Transcript ENSMUST00000030991
Sequence
AAACGTTCCGGGAAGGCTGGTTTTCGCTCCCCCTGTGTGGAGAAGTTGGAGACGCCCAAGTCCCCACGGAAGGCCTACAGCCATGTCGTCTGGGGACCCA

AGGTCTGGTAGACAGGACGGGGCCCCGCGTGCGGCCGCAGCGCTCTGTGGCCTGTACCACGAGGCCGGCCAGCAACTACAGCGCCTGAAGGATCAGCTGG

CCGCGCGTGACGCCCTCATCGCGAGCCTCCGCACCCGCCTCGCGGCTCTGGAAGGGCACACGGCGCCGTCACTCGTGGACGCACTTCTGGATCAGGTGGA

GCGCTTCCGTGAGCAGCTGCGACGACAGGAGGAAGGCGCTTCGGAGACCCAGCTGCGGCAG - UNI21033 - GAAGTTGAAAGACTTACGGAGCGTC

TAGAGGAAAAAGAGAGGGAGATGCAACAGCTGATGAGCCAGCCTCAGCATGAGCAAGAGAAGGAGGTAGTCTTGCTTCGGCGAAGTGTGGCAGAGAAGGA

GAAAGCCAGGGCCGCCAGTGATGTTCTGTGCCGCTCCTTGGCTGATGAGACCCACCAACTGCGCAGGACATTGGCAGCCACTGCCCACATGTGCCAACAT

CTGGCCAAATGTCTGGATGAACGACAGTGTGCACAGGGAGACGCTGGGGAGAAAAGCCCTGCTGAG GAGGTAAGATGGATCTGTGGCCAGGCCTACACC

AAGGACCTGAAAAAGCCTCCTGGATGCTGG CTAGAGCAAACAAGCAGCGATGCTTCTGGCCAGAGTGTTATTAAGAAGTTACAGGAAGAAAATCGACTG

TTAAAACAGAAGGTGACTCAT GTAGAAGACCTCAATGCTAAGTGGCAGCGTTATGATGCAAGTAGGGACGAATATGTGAAGGGGTTGCATGCCCAGCTA

AAGAGGCGGCAGGTCCCTCTGGAGCCTGAGCTGATGAAGAAGGAGATTTCCCGACTTAACAGACAGTTGGAGGAGAAAATAAGTGACTGTGCGGAAGCAA

ACCAGGAGCTGACAGCCATGAGGATGTCCCGGGACACTGCGCTGGAGCGAGTGCAGATGCTAGAACAGCAG ATTCTTGCTTACAAGGATGACTTCAAAT

CAGAAAGGGCAGATCGGGAACGAGCGCACAGTAGGATTCAAGAGCTGGAGGAAAAGATCATGTCCTTGATGTACCAAGTGTCCCAGAGACAG GACTCCC

GGGAGCCAGGACCCTGTCGGATTCATACGGGGAACAAAACTGCCAAGTACTTAGAGATGGATGCACTGGAGCATGTGACCCCTGGCGGCTGGAGGCCTGA

GTCTAGGTCCCAACAGATGGAACCTTCTGCAGAGGGTGGGCATGTGTGCACAGCCCAGAGAGGTCAGGGTGACCTTCAGTGCCCTCATTGCCTGCGGTGC

TTCAGTGATGAGCAAGGCGAGGCATTCCTCAGGCACCTGTCTGAGTGCTGCCAATGAGCCAGACATTGCCCGTGTGACCCATGACCACCATAGCTGCTCT

AAGGGACTGGGAGGGGTCCTCAGACTCAGTTTTCAACTCAGTGTGTTGCATTCTCCTGGGATCTAGGGCCCAAATGGGCAGGGTCACTGGAAGGTCATCT

TGTTTTCATTTGACCATGGTGAGACTTGGTCAGAGGGAACTATTGACAGAGCAGGAGGAAGAGGTGGGGTCAGGGACATCAAGTGGACATCAGTTTTGTC

TCACGTAGAGTTTGGAGTGAGCTGTCAATTCAAAGCTGCAAGCTATCAGTTGTGGGAATATTCTGAAGCCTGCTTGCACCTAGAGTTATGCCACTTGCTG

GAAGGGGAAGTTGCTGTGGGAGCAGTGTGTCCTCTTTCCAGGGTGGTAGCTCCATCCTGTTGAGTAGTGAGATACACTCCCTGACTGGTCTGTGCTGCAT

TACAGTTACATGATACACTAGAACCTTCCCAAACTCAGCAGAGCCACACAGCTGCATCCAGTACCATCACCCTGCAAAACACTTGTATTTCCAAAAGGGA

AAGCACCTTTATTTCCTAATCATTTATTTTTATAATAAATGGCTTTAC
Translation
MSSGDPRSGRQDGAPRAAAALCGLYHEAGQQLQRLKDQLAARDALIASLRTRLAALEGHTAPSLVDALLDQVERFREQLRRQEEGASETQLRQ - UNI2

1033 - EVERLTERLEEKEREMQQLMSQPQHEQEKEVVLLRRSVAEKEKARAASDVLCRSLADETHQLRRTLAATAHMCQHLAKCLDERQCAQGDAGEK

SPAE EVRWICGQAYTKDLKKPPGCW LEQTSSDASGQSVIKKLQEENRLLKQKVTH VEDLNAKWQRYDASRDEYVKGLHAQLKRRQVPLEPELMKKEI

SRLNRQLEEKISDCAEANQELTAMRMSRDTALERVQMLEQQ ILAYKDDFKSERADRERAHSRIQELEEKIMSLMYQVSQRQ DSREPGPCRIHTGNKTA

KYLEMDALEHVTPGGWRPESRSQQMEPSAEGGHVCTAQRGQGDLQCPHCLRCFSDEQGEAFLRHLSECCQ

For any suggestions or comments, please send an email to unitrap@crg.es