Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000059883 (Irak4)
Chromosomal location
Chr 15: 94374091 - 94412246 (+)
Description
interleukin-1 receptor-associated kinase 4 Gene [Source:MGI (curated);Acc:Irak4-002]
RefSeq_dna
NM_029926 
RefSeq_peptide
NP_084202.2 
UniGene
Mm.422858 
MGI
MGI:2182474 
Uniprot/SWISSPROT
Q8R4K2 
Uniprot/SPTREMBL
Q9D250 Q3USX5 
Human Ortholog
ENSG00000198001 (IRAK4)
Omim 607676 - IRAK4 DEFICIENCY  610799 - INVASIVE PNEUMOCOCCAL DISEASE, RECURRENT ISOLATED, 1  
UniTrap UNI32301
Vector Insertion
Chr 15: 94393512 - 94397169
Public Clones IST12349G1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 88% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000076097
Sequence
ATGAACAAGCCGTTGACACCATCGACATACATACGCAACCTTAATGTGGGGATCCTTAGGAAGCTGTCGGATTTTATTGATCCTCAAGAAGGGTGGAAGA

AATTAGCAGTAGCTATCAAAAAGCCGTCCGGCGACGACAGATACAATCAGTTCCATATAAG GAGATTCGAAGCCTTACTTCAGACCGGGAAGAGCCCCA

CCTGTGAACTGCTGTTTGACTGGGGCACCACGAACTGCACAGTTGGCGACCTTGTGGATCTACTGGTCCAGATTGAGCTGTTTGCCCCCGCCACTCTCCT

GCTGCCGG ATGCCGTTCCCCAAACCGTCAAAAGCCTGCCTCCTAGAGAA GGCAACAGTGGCACAAACACACGGGCCTTGTCAGGAAAAGGACAGGACA

TCCGTAATGCCTATGCCGAAGCTAGAACACAGCTGCGAGCCACCGGACTCCTC AGCCCAGACAACAGAAGTGTAGAGTCCAGCGACACTC GGTTCCAC

AGCTTCTCGTTCCATGAACTGAAGAGCATCACAAACAACTTCGACGAGCAACCCGCGTCTGCCGGTGGCAACCGGATGGGAGAGGGGGGATTT
Translation
MNKPLTPSTYIRNLNVGILRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIR RRFEALLQTGKSPTCELLFDWGTTNCTVGDLVDLLVQIELFAPAT

LLLPD DAVPQTVKSLPPRE GNSGTNTRALSGKGQDIRNAYAEARTQLRATGLL SPDNRSVESSDTR RFHSFSFHELKSITNNFDEQPASAGGNRMG

EGGF
Transcript ENSMUST00000109247
Sequence
CCTCCCTGTCCCACAGGGGGATATGATGCCCCGGTGACCCGCAGCATCCCGATCGCAGGCAGTCTGAAGTCGCCTGGTGGTCCTGCGTCCTCCACCCCCG

AGTCCTCGCCGGACCGTGGCGGGACGCCGATCGCCTTGTCCAGGAAGCGAGGGACGTCCGAGAGGAA GTAGAAGATGAACAAGCCGTTGACACCATCGA

CATACATACGCAACCTTAATGTGGGGATCCTTAGGAAGCTGTCGGATTTTATTGATCCTCAAGAAGGGTGGAAGAAATTAGCAGTAGCTATCAAAAAGCC

GTCCGGCGACGACAGATACAATCAGTTCCATATAAG GAGATTCGAAGCCTTACTTCAGACCGGGAAGAGCCCCACCTGTGAACTGCTGTTTGACTGGGG

CACCACGAACTGCACAGTTGGCGACCTTGTGGATCTACTGGTCCAGATTGAGCTGTTTGCCCCCGCCACTCTCCTGCTGCCGG ATGCCGTTCCCCAAAC

CGTCAAAAGCCTGCCTCCTAGAGAAGCGGCAACAGTGGCACAAACACACGGGCCTTGTCAGGAAAAGGACAGGACATCCGTAATGCCTATGCCGAAGCTA

GAACACAGCTGCGAGCCACCGGACTCCTCAAGCCCAGACAACAGAAGTGTAGAGTCCAGCGACACTC GGTTCCACAGCTTCTCGTTCCATGAACTGAAG

AGCATCACAAACAACTTCGACGAGCAACCCGCGTCTGCCGGTGGCAACCGGATGGGAGAGGGGGGATTTGGAGTGGTGTACAAGGGCTGTGTGAACAACA

CCATCGTGGCGGTGAAGAAGCTCGGAGCG ATGGTTGAAATCAGTACTGAAGAACTAAAGCAACAGTTTGATCAAGAAATTAAAGTAATGGCAAC GTGT

CAGCACGAGAACCTGGTGGAGCTGCTCGGCTTCTCCAGCGACAGCGACAACCTGTGCTTAGTGTATGCTTACATGCCCAACGGGTCCTTGCTGGACAGAC

TGTCCTGCCTG GATGGTACACCACCGCTTTCCTGGCACACAAGGTGCAAGGTTGCTCAGGGGACAGCAAATGGCATCAGGTTTCTGCATGAAAATCATC

ACATTCATAGAGATATTAAAAG TGCAAATATCTTACTAGACAAAGACTTTACTGCCAAAATATCTGACTTTGGGCTTGCACGGGCTTCGGCAAGGCTAG

CGCAGACGGTCATGACCAGCCGAATCGTGGGCACAACGGCTTACATGGCACCCGAAGCTTTGCGGGGAGAAATAACACCCAAATCTGACATCTACAGCTT

CGGCGTG GTTCTGTTGGAGCTGATAACCGGGCTGGCGGCTGTGGATGAAAACCGTGAACCTCAACTACTG - UNI32301 - CTGGATATTAAAGAA

GAGATTGAAGATGAAGAGAAGACGATTGAAGATTACACGGATGAGAAGATGAGCGATGCGGACCCTGCTTCGGTGGAAGCAATGTACTCTGCTGCTAGCC

AGTGTCTGCATGAGAAGAAAAACAGACGGCCAGACATTGCAAAG GACATCGGCTTA
Translation
 MNKPLTPSTYIRNLNVGILRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIR RRFEALLQTGKSPTCELLFDWGTTNCTVGDLVDLLVQIELFAPA

TLLLPD DAVPQTVKSLPPREAATVAQTHGPCQEKDRTSVMPMPKLEHSCEPPDSSSPDNRSVESSDTR RFHSFSFHELKSITNNFDEQPASAGGNRMG

EGGFGVVYKGCVNNTIVAVKKLGA MVEISTEELKQQFDQEIKVMAT TCQHENLVELLGFSSDSDNLCLVYAYMPNGSLLDRLSCL DGTPPLSWHTRC

KVAQGTANGIRFLHENHHIHRDIKS SANILLDKDFTAKISDFGLARASARLAQTVMTSRIVGTTAYMAPEALRGEITPKSDIYSFGV VLLELITGLAA

VDENREPQLL - UNI32301 - LDIKEEIEDEEKTIEDYTDEKMSDADPASVEAMYSAASQCLHEKKNRRPDIAK DIGL
Transcript ENSMUST00000109248
Sequence
ACAGGGGGATATGATGCCCCGGTGACCCGCAGCATCCCGATCGCAGGCAGTCTGAAGTCGCCTGGTGGTCCTGCGTCCTCCACCCCCGAGTCCTCGCCGG

ACCGTGGCGGGACGCCGATCGCCTTGTCCAGGAAGCGAGGGACGTCCGAGAGGAA GTAGAAGATGAACAAGCCGTTGACACCATCGACATACATACGCA

ACCTTAATGTGGGGATCCTTAGGAAGCTGTCGGATTTTATTGATCCTCAAGAAGGGTGGAAGAAATTAGCAGTAGCTATCAAAAAGCCGTCCGGCGACGA

CAGATACAATCAGTTCCATATAAG GAGATTCGAAGCCTTACTTCAGACCGGGAAGAGCCCCACCTGTGAACTGCTGTTTGACTGGGGCACCACGAACTG

CACAGTTGGCGACCTTGTGGATCTACTGGTCCAGATTGAGCTGTTTGCCCCCGCCACTCTCCTGCTGCCGG ATGCCGTTCCCCAAACCGTCAAAAGCCT

GCCTCCTAGAGAAGCGGCAACAGTGGCACAAACACACGGGCCTTGTCAGGAAAAGGACAGGACATCCGTAATGCCTATGCCGAAGCTAGAACACAGCTGC

GAGCCACCGGACTCCTCAAGCCCAGACAACAGAAGTGTAGAGTCCAGCGACACTC GGTTCCACAGCTTCTCGTTCCATGAACTGAAGAGCATCACAAAC

AACTTCGACGAGCAACCCGCGTCTGCCGGTGGCAACCGGATGGGAGAGGGGGGATTTGGAGTGGTGTACAAGGGCTGTGTGAACAACACCATCGTGGCGG

TGAAGAAGCTCGGAGCG ATGGTTGAAATCAGTACTGAAGAACTAAAGCAACAGTTTGATCAAGAAATTAAAGTAATGGCAAC GTGTCAGCACGAGAAC

CTGGTGGAGCTGCTCGGCTTCTCCAGCGACAGCGACAACCTGTGCTTAGTGTATGCTTACATGCCCAACGGGTCCTTGCTGGACAGACTGTCCTGCCTG 

GATGGTACACCACCGCTTTCCTGGCACACAAGGTGCAAGGTTGCTCAGGGGACAGCAAATGGCATCAGGTTTCTGCATGAAAATCATCACATTCATAGAG

ATATTAAAAG TGCAAATATCTTACTAGACAAAGACTTTACTGCCAAAATATCTGACTTTGGGCTTGCACGGGCTTCGGCAAGGCTAGCGCAGACGGTCA

TGACCAGCCGAATCGTGGGCACAACGGCTTACATGGCACCCGAAGCTTTGCGGGGAGAAATAACACCCAAATCTGACATCTACAGCTTCGGCGTG GTTC

TGTTGGAGCTGATAACCGGGCTGGCGGCTGTGGATGAAAACCGTGAACCTCAACTACTG - UNI32301 - CTGGATATTAAAGAAGAGATTGAAGAT

GAAGAGAAGACGATTGAAGATTACACGGATGAGAAGATGAGCGATGCGGACCCTGCTTCGGTGGAAGCAATGTACTCTGCTGCTAGCCAGTGTCTGCATG

AGAAGAAAAACAGACGGCCAGACATTGCAAAG GACCTTTCGGTTTAGCAAAACTCTGCTTATGTGCATGCTGCTTGGGGTGGACTTCATCGTACAGGAA

ATCCGCAGTCAGCTCATCCCCATTGTCTATCTCAATCTGCAAGAGAGGAAGGCACCACCGGGGTTAAACAACGTCAGGGAACCTTCACAACTGCCGCACT

GTACGCCGGCGCCCAGCTGCGGATGCCTCCATGAGTGTACCCACACCTTCCACATGAGAACAAGCAAGGGCTGCGGCTGTAACGCCTGCTGCCTTCCATC

CCTTCTGGGAGACACTAGTGCAGCCTCTCAGCGCGGCTCTAAAGGTAACATTTCCCGGCAGCAGCGAGCACTGCGGCCTCCAGCTGCCCTGCCTTATGAA

TTCAAACCCCTCACTTGCTCCTTCATCCCCTGGGCTACCTAGAGTCTCTCTACAACAGGGCTAGGCCAGCGATGGCCCACAGACCAAATCTCCAGCCCAA

CTTTAGGGCAATTCACACTTTAAGGGGCTTCAAAAACAAGGGGAAGACACCCAGGTCTGCTGGCAAAGCCTAAGAGGTTTGCTGTCTGGTCTTGTGCAGC

GTCAGCTGACCCTTTGTGAAAGGTGCTAGCATACACTGAGTGATGGACGGGATCTAGAACTGCCCCAGGCTCAGCACCCAACACCAGCGGTTGATAAGGA

AGAATCTTTGCCTATATCCTAGCGGCCTTTAAGAAGATATATGGAGATCTGGTAGCAACACCCCACTTTGTAAACTGCAGAAATGTTCTATATGTTGCAA

TCCTAATGCTACAGATGGCCAGTGAGCACTAGTGATAATCAGTGTTAAGGAAGGGAATCTTACATTTTATTCTGTTTACACTTAGCCAGCCACAGTGGCT

TATAGCTACCACGCACTTAGCGCATATCTAACCATGGGCTAAGACAGGGCACTCTGCAGGCTCCAAGGACTGAGGATGGAAACCCTAAGACTAAGTACTC

TCCTGTGTGAGCCACGACACCACACTGGACAGCATGGGAATGAAGGGCAGACTGGAGCAACATCCGTATGCTGAAACGGCACGGCCCACCTTTCTGATCA

CATCCATCTGTAGCTGTCGCTCTACAATCTCGAGCAGAGGGCTCTTGCAGCTGGAATACAGCATCCGCTCTCTTATGCTGCACGTGTATCCAGGCATCGA

ATAAATAAAAACTGTAAGTTCAAATAACAACAAGTAGAAATGTCAACAAAAGCAAGTCTATAACCTTCCTCAAATTGCATCTAAGCTCCTGGCAAGAAGC

TCAGAAGCATACAGTGCTGAGACAGAAGGTACCACACGGAAGACAAGGCAGGCGTCACATACCTACGGACTCTAAGTAGTCTCCTTCGTGGGAATGCTTG

TACAGAAAGAAATGGTAACGCGCTGAATCCTTGGGAATCCTCTTTGGCAAATCTCTCAGTTCTGTATTTTCTGTGTTGGCCAAAATTATTGTTTCATTTT

TTATATCTATTTCCTATCAAAAAGAAACAGCACTTGTGAAACAGGTAAAACATAAATTAACTTAGATGAGAGTCAAAGATGATGTACAGAGGTGTAGACT

GTCAGGAGCCATCGAAGAGATGCTAAGGCCTTCCCAGAGGAGGCCCACCTTCTTGCATGAACTAAAATGGGCGAGCTCTGAGAGGCAAGGTCCCAGAAAG

ACTTCATCTCAAGACTGTTTCTTGTAGCTGAAATGTCTTTCCTGTTATTATTAAATTAATATAATAATCCGTGGGCATTAGCCTACCCTATTGAGTAGAT

TTTCTGCAGATCAACATAAAGATAAACATTCATGAATTAATGCTTTTTAGATAAATTAATGACTTTACAAACTTCCCTGATTTGAATCAAATAAGGTTAG

GAATAAAGTTTTAAGATATGGTTGTTTTGCTAGAAAGACGTAATAAAGTTAGTATTAAGAA
Translation
 MNKPLTPSTYIRNLNVGILRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIR RRFEALLQTGKSPTCELLFDWGTTNCTVGDLVDLLVQIELFAPA

TLLLPD DAVPQTVKSLPPREAATVAQTHGPCQEKDRTSVMPMPKLEHSCEPPDSSSPDNRSVESSDTR RFHSFSFHELKSITNNFDEQPASAGGNRMG

EGGFGVVYKGCVNNTIVAVKKLGA MVEISTEELKQQFDQEIKVMAT TCQHENLVELLGFSSDSDNLCLVYAYMPNGSLLDRLSCL DGTPPLSWHTRC

KVAQGTANGIRFLHENHHIHRDIKS SANILLDKDFTAKISDFGLARASARLAQTVMTSRIVGTTAYMAPEALRGEITPKSDIYSFGV VLLELITGLAA

VDENREPQLL - UNI32301 - LDIKEEIEDEEKTIEDYTDEKMSDADPASVEAMYSAASQCLHEKKNRRPDIAK DLSV
Transcript ENSMUST00000074936
Sequence
CCTCCCTGTCCCACAGGGGGATATGATGCCCCGGTGACCCGCAGCATCCCGATCGCAGGCAGTCTGAAGTCGCCTGGTGGTCCTGCGTCCTCCACCCCCG

AGTCCTCGCCGGACCGTGGCGGGACGCCGATCGCCTTGTCCAGGAAGCGAGGGACGTCCGAGAGGAA GTAGAAGATGAACAAGCCGTTGACACCATCGA

CATACATACGCAACCTTAATGTGGGGATCCTTAGGAAGCTGTCGGATTTTATTGATCCTCAAGAAGGGTGGAAGAAATTAGCAGTAGCTATCAAAAAGCC

GTCCGGCGACGACAGATACAATCAGTTCCATATAAG GAGATTCGAAGCCTTACTTCAGACCGGGAAGAGCCCCACCTGTGAACTGCTGTTTGACTGGGG

CACCACGAACTGCACAGTTGGCGACCTTGTGGATCTACTGGTCCAGATTGAGCTGTTTGCCCCCGCCACTCTCCTGCTGCCGG ATGCCGTTCCCCAAAC

CGTCAAAAGCCTGCCTCCTAGAGAAGCGGCAACAGTGGCACAAACACACGGGCCTTGTCAGGAAAAGGACAGGACATCCGTAATGCCTATGCCGAAGCTA

GAACACAGCTGCGAGCCACCGGACTCCTCAAGCCCAGACAACAGAAGTGTAGAGTCCAGCGACACTC GGTTCCACAGCTTCTCGTTCCATGAACTGAAG

AGCATCACAAACAACTTCGACGAGCAACCCGCGTCTGCCGGTGGCAACCGGATGGGAGAGGGGGGATTTGGAGTGGTGTACAAGGGCTGTGTGAACAACA

CCATCGTGGCGGTGAAGAAGCTCGGAGCG ATGGTTGAAATCAGTACTGAAGAACTAAAGCAACAGTTTGATCAAGAAATTAAAGTAATGGCAAC GTGT

CAGCACGAGAACCTGGTGGAGCTGCTCGGCTTCTCCAGCGACAGCGACAACCTGTGCTTAGTGTATGCTTACATGCCCAACGGGTCCTTGCTGGACAGAC

TGTCCTGCCTG GATGGTACACCACCGCTTTCCTGGCACACAAGGTGCAAGGTTGCTCAGGGGACAGCAAATGGCATCAGGTTTCTGCATGAAAATCATC

ACATTCATAGAGATATTAAAAG TGCAAATATCTTACTAGACAAAGACTTTACTGCCAAAATATCTGACTTTGGGCTTGCACGGGCTTCGGCAAGGCTAG

CGCAGACGGTCATGACCAGCCGAATCGTGGGCACAACGGCTTACATGGCACCCGAAGCTTTGCGGGGAGAAATAACACCCAAATCTGACATCTACAGCTT

CGGCGTG GTTCTGTTGGAGCTGATAACCGGGCTGGCGGCTGTGGATGAAAACCGTGAACCTCAACTACTG - UNI32301 - CTGGATATTAAAGAA

GAGATTGAAGATGAAGAGAAGACGATTGAAGATTACACGGATGAGAAGATGAGCGATGCGGACCCTGCTTCGGTGGAAGCAATGTACTCTGCTGCTAGCC

AGTGTCTGCATGAGAAGAAAAACAGACGGCCAGACATTGCAAAG GTTCAACAGCTGCTACAAGAGATGTCTGCTTAAAACTAATAAACTTTTTTTTTTT

TTTTTTTACTTCTCGAGAACCTGGAGACCGGAAAAGCACTTTGACACTGAGCTGCGTCACCTACCTGTTGTTTGCATTTGTTTTTGTTTTCCTAAATGCG

CTTTATGTTTAACATGGTAGCATAGTGCAATGTACCAATGTACTGGTTAGTTAGTTAATAGACGAGTTGGCACCGCAGCCAAAGTGATAGTTGCATGGTA

GCACTTGGCCCCGCCCACCTAGTATGGGGCTCATGTTCCACAGCAACATCACCAAACTATAGTGAACTTAAGATTCAGGAAAACAGCACTGTGCTATACA

GAGACAATAGGATTATTTGGGGCGGGGGGAGTGAGACACGGTGTCTCTGTGTAGCCCTGGATGTCCTGGAACTTGCTCTGTAGACCAGGCTGGCCTTGAA

CTCAGCAATCTGCCTGTCTCTGCCTACTGCGTGTTGGGATTAAAGGTGTGTGCCACTCCTGTAAAGCTTTGGACCAGCTCTTAGCTGCCTTAAGCCTTAG

TGCTGGCTTTTGGTTTTTGATAGGAACTTCATGCTCCTGTAAATAGCTCCTCACCTAGGTTCCTGTAAGGAACCTCTCTCCACTGCTCCTGTAACCCTAA

CTAAACTCATTGGTTCAACAATGTAGACATGAGTGGAATCTATTCTTCTGTCTGTTATTGTGGTCCTATTTTGAATGAATAGATGTTTGCTTGTCATCCC

TCCCCCCCCACCCCAATTCACATACATGGTACTATACGTGGGGTATAACAGAACCAATAGTGAGTTTGGAGGGTGTGTGTGTGTGTGCTTGTATTGTCTC

TGCAATGGGCAATAAAACATGTAACTGAGGCCAAGCTGTCTGAGGGGGGAGCATTTAAGGGGGCAATTCCGACACCACCCTTTCCCTTATGGTAGACATG

GTAGGCCCCCTTGCTGTATATTGATTGTACTGCTCCCGCTGAAGTAAAAAGACATATAACTTCCACAGGCCTGCTCCATCTGCATGAGTCTCTGTAAAGA

AAGTTCTGGAGAGGCCATTTTCCTCTATCAATGGACAAAGGAATGCCTCTATAATGAATGGAATCAGCCATTCCGTACTACAGTTCTTGAAGGTAGCACA

TATGAGATGGGGTCATAAGCACCCTGTGGCATCACTAAGACTTGCCACTAGAGCTGAGCTGTCTCTTCAGCCTGCCTGTTTAAGCAGAGAATTACAAGAT

GCAGATGCTATGTATCCTCTGAACTGGCAGGTAAAATG
Translation
 MNKPLTPSTYIRNLNVGILRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIR RRFEALLQTGKSPTCELLFDWGTTNCTVGDLVDLLVQIELFAPA

TLLLPD DAVPQTVKSLPPREAATVAQTHGPCQEKDRTSVMPMPKLEHSCEPPDSSSPDNRSVESSDTR RFHSFSFHELKSITNNFDEQPASAGGNRMG

EGGFGVVYKGCVNNTIVAVKKLGA MVEISTEELKQQFDQEIKVMAT TCQHENLVELLGFSSDSDNLCLVYAYMPNGSLLDRLSCL DGTPPLSWHTRC

KVAQGTANGIRFLHENHHIHRDIKS SANILLDKDFTAKISDFGLARASARLAQTVMTSRIVGTTAYMAPEALRGEITPKSDIYSFGV VLLELITGLAA

VDENREPQLL - UNI32301 - LDIKEEIEDEEKTIEDYTDEKMSDADPASVEAMYSAASQCLHEKKNRRPDIAK VQQLLQEMSA

For any suggestions or comments, please send an email to unitrap@crg.es