Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000059939 (9430015G10Rik)
Chromosomal location
Chr 4: 155484089 - 155501368 (+)
Description
RIKEN cDNA 9430015G10 gene Gene [Source:MGI Symbol;Acc:MGI:2444364]
RefSeq_dna
NM_145557 
RefSeq_peptide
NP_663532.1 
UniGene
Mm.399514 Mm.428049 
MGI
MGI:2444364 
Uniprot/SPTREMBL
A2ASP7 Q99KU2 Q8BSD8 
Human Ortholog
ENSG00000131591 (C1orf159)
Omim not available
UniTrap UNI26711
Vector Insertion
Chr 4: 155488037 - 155488111
Public Clones not available
Private Clones OST102604 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000072554
Sequence
CGCGCGCAGGGCGGCCGGTACGAAAGGAGCTCGGCTGGCGAGTG AATTCCTCTATCTAGGAAGCTCAGACTACTATTGTTCCAGAATTGGAAATGCCCA

GCTTGCCTGCTCCTTCAATGCTTCGGGGGCCGCTGCTAAGTAAAAAGTCTTCATAGAG - UNI26711 - ATCTCCTTGTCAGCTCCCCAGCATGGCA

CTGCAGTGTCTCCTGCTCCTGACTGGCCTTCTGACAGGAGGCGTGTGCAAGTCCACAGAAAGCCAG GCCCAGCAACCTGAGTGTTGCATGGATGTGGTA

GACTTCAATGCTACCTGCCTCGGTACAGGTCTCTGTGGCCCAG GTTGCTACAGGCACTGGAATGCAGATGGGAGCGCTAGCTGTGTCCGGTGCTGGAAT

GGGACCCTCCCGACATACAATGGCTCTGAGTGTAGAATTC TCACTGGCCGGGGCGTGCAGCTTCCCATGAACAGGAGCACGGGGACACCTGGACAGCCA

CATTTTG GGGGTCCTCATGTGGCAGCTTCTCTCTTCCTGGGGACACTCTTCATCAGCACAGGCCTCATCCTCTCTGTGGCTGGATTCTTCTACCTCAAG

CGCTCCAGCAAACTTCCTGAGGTTTTCTACAGGAGAGACAGAG CCCCTGTCCTGCAGCCTGGTGAGACA GCTGCCATGGTCCCCCTGCCACAGTCTTC

AG TGAGGAAGCCAAGATACATCCGGCGTGAGCAGCACCCAGACAAGAATAGGGACCCTTCTGCCTTCTCTACAGTGGAGGCCCACATCAGCAACGTCTG

ATCTAGAGGTCAACTGAGACTTCACAGTACAGCAGTGGAGACCCAAGGCCCCCTCCAGTGAGCTCACTACACAAAGGGCCTGGGCCTTAAGATATGCCAG

AATGGACTCCCAATGGCAGACATGCACGAATGCTAGGGGGATGCTAACGTCCATGCCATGAGATCGTCACTGTGTGGTTTAACAGGAGCAACCATCTGTG

AGACTGAGGACTCAAGAGCAAGTCATGTGGGGTCTGTGCCCCTTAAGAGTAACAGCATCTATAGCAGCTATAACACAGACCTGATCCAAACGGTCAAAAC

TTCTGGAGCCCACCCACTGGAGCCCATAGTAGACAGGACTCCATTCCCACCGAGCTAAGAAGATGAAACCAAGGTTCCAACAGTGGAGAAAACAGCCTGG

ATACTGGTTCCAGAGATAGGTTGCTCTAGTGTCAGCCTGCTAATTTAGCTGCTGACCTCTCAAGGCCCATGTTTCTCAGAGTTGCAGAATTGAGTATCCT

TGGTTTTCTGATTCCAGAAGCCAGCAAGCAGAGCCTTGTCTTCCAGGGACAGACTCCACCCAGTACCTTCAGGCTGGGCACTCAGAGCAAAATGTTTACC

CGTGGGGCCTCCATCTCTGAACACTTAGGTCACTTGTCCCCTTGGGCTTGTGAGCTCATGCTGGTTAGCAGTCCTGTCTTTGCTCTCCTAAGACTCCAGA

AGCCTGTGAGCTGCTAGTGTGGCTGGTGGTGTTGGCCATGTGTCCCTATAGAAGGAGGTGGCCTGATGACCAGTGCCATCCTCCGTCTAGCATCTTCTTT

GACGTCAAGCACACATCTGATGTTATGCACAGTGTTAGGAGTTTGCTTTCCCAGAGTTGAGCCAGTGACTCAGGTAGCAGCAGCAATTCCAAGCTGGACC

AATTCAATTAGACTAGATCTTCTCTCCTCAAGCTTTGTTGTCCCAAGGTCTCGTATTCAGTGTGGTGTGTGGGAGCGAACTACCCCATTGCCATGTCCAG

GGGACAAGTAGGGAGGGGAAGAAGAAGCCCTCAGCCGGACTCAGAGCCTACTGTTGTCTGGTGGAACTGGCAGTGCAGCACAACCCATCCCCTCATCTTT

CCCTGGCCATGTAGCCCCTCCCATTTCAGGACACCATCTTGCATGAAGAGGTGACCCCGCTCCTTAGGACTTGAGGTAGAAAGTGCCAGTCAAGCACGGC

ATGGTTTTCAGATAAGACTACATGCATCACTAGGCTTTGAGGGGGCCACTGGCAGTTTATGGATCTAATTGACCCTTGGGGAAAGCAGAACCCTCGACCT

GGCCACCTGAGTTCATTTTAGTGGTCCCCCTCAAAGCCCATGTGTAGACGTACAGATGTGTGTCTGCTGACTAGAGGCAGAACCGGATAAAGAGAGCCAA

ATGAGAGCTTAGGGATTCTAGAAGTCCTGCCAGGTAGTTTGATAAGAATGCCTACCCAGTGCCCCCAGGCTTACATACTTGAATTGCTGAGTCATCAGGG

ATTACGGGAGAGGCTTAGGAGGTGTGGCTTTATTGGAGGAAGTGTGTCTCTGGGGATGGGCATTGGGTCTCAAAAGCTCAAGCCAGGCCCAGTGGCTTTC

ATTTCCTGCTGCCTGTGGATTTGGATGTAGAGCTCTCAGCTCCTCGTCCAGCACCATGTCCGCCTATGCTACCATGCTTCCTGCCGTTCCGATAATGGAC

TAAACCTCTGAAACAGTAGACAAGCCCCAATTAAATACTTTGTTTT
Translation
  - UNI26711 - MALQCLLLLTGLLTGGVCKSTESQ AQQPECCMDVVDFNATCLGTGLCGPG GCYRHWNADGSASCVRCWNGTLPTYNGSECRIL

 LTGRGVQLPMNRSTGTPGQPHFG GGPHVAASLFLGTLFISTGLILSVAGFFYLKRSSKLPEVFYRRDRA APVLQPGET AAMVPLPQSSV VRKPRY

IRREQHPDKNRDPSAFSTVEAHISNV
Transcript ENSMUST00000105576
Sequence
ACGAAAGGAGCTCGGCTGGCGAGTG - UNI26711 - AATTGGAAATGCCCAGCTTGCCTGCTCCTTCAATGCTTCGGGGGCCGCTGCTAAGTAAAAA

GTCTTCATAGAG - UNI26711 - ATCTCCTTGTCAGCTCCCCAGCATGGCACTGCAGTGTCTCCTGCTCCTGACTGGCCTTCTGACAGGAGGCGTGT

GCAAGTCCACAGAAAGCCAG GCCCAGCAACCTGAGTGTTGCATGGATGTGGTAGACTTCAATGCTACCTGCCTCGGTACAGGTCTCTGTGGCCCAG TC

ACTGGCCGGGGCGTGCAGCTTCCCATGAACAGGAGCACGGGGACACCTGGACAGCCACATTTTG GGGGTCCTCATGTGGCAGCTTCTCTCTTCCTGGGG

ACACTCTTCATCAGCACAGGCCTCATCCTCTCTGTGGCTGGATTCTTCTACCTCAAGCGCTCCAGCAAACTTCCTGAGGTTTTCTACAGGAGAGACAGAG

 CCCCTGTCCTGCAGCCTGGTGAGACA GCTGCCATGGTCCCCCTGCCACAGTCTTCAG TGAGGAAGCCAAGATACATCCGGCGTGAGCAGCACCCAGA

CAAGAATAGGGACCCTTCTGCCTTCTCTACAGTGGAGGCCCACATCAGCAACGTCTGATCTAGAGGTCAACTGAGACTTCACAGTACAGCAGTGGAGACC

CAAGGCCCCCTCCAGTGAGCTCACTACACAAAGGGCCTGGGCCTTAAGATATGCCAGAATGGACTCCCAATGGCAGACATGCACGAATGCTAGGGGGATG

CTAACGTCCATGCCATGAGATCGTCACTGTGTGGTTTAACAGGAGCAACCATCTGTGAGACTGAGGACTCAAGAGCAAGTCATGTGGGGTCTGTGCCCCT

TAAGAGTAACAGCATCTATAGCAGCTATAACACAGACCTGATCCAAACGGTCAAAACTTCTGGAGCCCACCCACTGGAGCCCATAGTAGACAGGACTCCA

TTCCCACCGAGCTAAGAAGATGAAACCAAGGTTCCAACAGTGGAGAAAACAGCCTGGATACTGGTTCCAGAGATAGGTTGCTCTAGTGTCAGCCTGCTAA

TTTAGCTGCTGACCTCTCAAGGCCCATGTTTCTCAGAGTTGCAGAATTGAGTATCCTTGGTTTTCTGATTCCAGAAGCCAGCAAGCAGAGCCTTGTCTTC

CAGGGACAGACTCCACCCAGTACCTTCAGGCTGGGCACTCAGAGCAAAATGTTTACCCGTGGGGCCTCCATCTCTGAACACTTAGGTCACTTGTCCCCTT

GGGCTTGTGAGCTCATGCTGGTTAGCAGTCCTGTCTTTGCTCTCCTAAGACTCCAGAAGCCTG
Translation
 - UNI26711 -  - UNI26711 - MALQCLLLLTGLLTGGVCKSTESQ AQQPECCMDVVDFNATCLGTGLCGPV VTGRGVQLPMNRSTGTPGQP

HFG GGPHVAASLFLGTLFISTGLILSVAGFFYLKRSSKLPEVFYRRDRA APVLQPGET AAMVPLPQSSV VRKPRYIRREQHPDKNRDPSAFSTVEA

HISNV

For any suggestions or comments, please send an email to unitrap@crg.es