Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000059975 (Zfp74)
Chromosomal location
Chr 7: 30715834 - 30739106 (-)
Description
zinc finger protein 72 Gene [Source:MGI (curated);Acc:Zfp74-003]
RefSeq_dna
NM_178384 
RefSeq_peptide
NP_848471.2 
UniGene
Mm.371648 
MGI
MGI:107784 
Uniprot/SWISSPROT
Q80W31 
Uniprot/SPTREMBL
Q60908 O88227 Q8BIJ3 
Human Ortholog
ENSG00000196437 (ZNF569)
Omim not available
UniTrap UNI32608
Vector Insertion
Chr 7: 30736732 - 30739107
Public Clones IST10469G4 (tigm) IST14729E3 (tigm) IST14667E4 (tigm) IST10262D3 (tigm)
IST14637H7 (tigm) IST14728B10 (tigm) IST11263E11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33340
Vector Insertion
Chr 7: 30728650 - 30736913
Public Clones IST14477E1 (tigm) IST10881E6 (tigm) IST14861D3 (tigm) IST14532C5 (tigm)
IST13566F10 (tigm) IST14635F8 (tigm) IST10048A11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2128
Vector Insertion
Chr 7: 30728509 - 30728560
Public Clones AD0564 (sanger)
Private Clones OST300404 (lexicon) OST218882 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34491
Vector Insertion
Chr 7: 30728509 - 30728775
Public Clones IST14120D5 (tigm) IST14623H3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13145
Vector Insertion
Chr 7: 30723088 - 30728509
Public Clones CMHD-GT_323A2-3 (cmhd) (cmhd) IST14151B11 (tigm) IST13339E10 (tigm)
IST14439G8 (tigm)
Private Clones OST303063 (lexicon) OST176856 (lexicon) OST110433 (lexicon)
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13034
Vector Insertion
Chr 7: 30722715 - 30722960
Public Clones CMHD-GT_338B4-3 (cmhd) CMHD-GT_421C9-3 (cmhd)
Private Clones OST211468 (lexicon)
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000085782
Sequence
ACAAAATAGAAAACCTGGTGATGAGCCACAGATAGCACCAGAGTTCTGCCCGCATTTAGTTCTGTGCCGGAACAGAACCAACAATTGAAAACACAGAAGT

GCATCTTCTCACAACGTCAACAAG - UNI2128 - - UNI33340 - - UNI34491 - CTTGCTCAGGACCTCCCCCCTAAAAAGAAGAGGAAAT

GACCGAGTCTGAG - UNI2128 - - UNI13145 - - UNI34491 - GGACTAGTGACGTTCAAAGACGTGGCCATTGATTTTACCCAAGAAGAA

TGGAAGCAACTGGATCCTACTCAGCGGAACCTATATAGGAATGTGATGCTAGAAAACTACAACAACTTAATCACAGTAG - UNI13034 - GCCCGCC

ACTCACCAAACCTGAAGTGATTTTCAAGTTGGAGCAAGAGGAAGAGCCTTGTGTGGTGGAGAGAGAAGTGCTGTGGAGACCCTGTCCAG GGGAGATTTT

GGGAATTGACGAGCACCAGAAAATCCAGGACGGACAAGTTTTCGAGGGAATAGTGGTGACGAGTGAAGCCAGCGAATGTCCGGAGGAATTTGCAAGTACG

TTTTTCCCAAACGCAGACTCCATTCCTTCCATGCACAGTCTCTTTGAATGTGAC TGTTGGAGAGTGTTT
Translation
 - UNI2128 - - UNI33340 - - UNI34491 - MTESE - UNI2128 - - UNI13145 - - UNI34491 - GLVTFKDVAIDFTQEEW

KQLDPTQRNLYRNVMLENYNNLITVG - UNI13034 - GPPLTKPEVIFKLEQEEEPCVVEREVLWRPCPG GEILGIDEHQKIQDGQVFEGIVVTSE

ASECPEEFASTFFPNADSIPSMHSLFECD CWRVF
Transcript ENSMUST00000108205
Sequence
GGGATCCTTTCGGATTCTTCTCAGTTGCAAGTTGCACCCCCAGGCTGTGAATGCCAGGCCGCGGGGTAGCCGCTGCTACAAAACCCGCCCAGGCTCAAGC

CGGTCCCCCTGCCGCAGCGCCGCGCCCTTACCCGAGCCTTGGCCACTCTCCTGACTCGCACGCCGAAGGCCAGACCCGCCCGGCGAGCCGCGCGGCCCTC

TGGGAAGTGCTACCCTGCGCCTAGCGGACCCAG - UNI32608 - - UNI33340 - CAGCTCTCATTTTCAGAGTTCTTCCTGCGCTGAGGAGCCT

TTTATAAACTCAATATTTATTGAATGTTGGACATATATCAGTCAATTGTTGGTGTGTGGGATATAGCAGCGAACAAAAGAAGCAGTGACCCCCCCCCCTC

TCATGATGCTTACATTGCCGAGGACCAGATAATAAACAAA - UNI32608 - - UNI33340 - - UNI34491 - TTCAGCTTGCTCAGGACCTC

CCCCCTAAAAAGAAGAGGAAATGACCGAGTCTGAG - UNI2128 - - UNI13145 - - UNI34491 - GGACTAGTGACGTTCAAAGACGTGGC

CATTGATTTTACCCAAGAAGAATGGAAGCAACTGGATCCTACTCAGCGGAACCTATATAGGAATGTGATGCTAGAAAACTACAACAACTTAATCACAGTA

G - UNI13034 - GCCCGCCACTCACCAAACCTGAAGTGATTTTCAAGTTGGAGCAAGAGGAAGAGCCTTGTGTGGTGGAGAGAGAAGTGCTGTGGAG

ACCCTGTCCAG GGGAGATTTTGGGAATTGACGAGCACCAGAAAATCCAGGACGGACAAGTTTTCGAGGGAATAGTGGTGACGAGTGAAGCCAGCGAATG

TCCGGAGGAATTTGCAAGTACGTTTTTCCCAAACGCAGACTCCATTCCTTCCATGCACAGTCTCTTTGAATGTGACGGTGTTGGAGAGTGTTTAGAGCCC

AATTTTGGTGATGATGATGTACAATACCCGTTGCCAGAGGAACAGTTTGAATATGACGATGCTATGCAGCCATTTCACACCAGCTCGCCCCATTTTGTGC

TGACCCCCTTTAAGTGCAACCATTGTGGAAAAGGCTTTAGTCAGACCCTGGACCTCATCAGACACCTGAGAGTTCACACAGGGGGGAAGCTCTATGAATG

CCACCAGTGTGGGAAAGGCTTTAGCCACAAGGAGAAGCTGATCAACCATCATAAGCTCCATAGCAGGGAGCAGTGTTACGAGTGTAGCGAGTGCGGGAAG

ACTTTCATCAAGATGTCAAATCTCATTAGACATCAAAGGATCCACACTGGGGAGAAGCCGTATGTGTGCCAGGAATGTGGGAAATCCTTCGGCCAGAAGT

CCAATCTCATTGATCACGAAAAAATTCACACTGGAGAGAAGCCTTACAAATGTAACGAATGTGGAAAATCCTTCAGCCAGAAACAAAGCCTTGTCGCACA

TCAGAAAGTTCACACTGGGGAGAAGCCTTACGCGTGCAACGAGTGTGGGAAAGCCTTCCCTCGCGTGGCTTCCCTTGCTCTGCATATGAGGGGCCACACA

GGGGAGAAGCCATACAAGTGTGATAAGTGTGGGAAAGCCTTCTCTCAGTTTTCCATGCTCATCATACACGTGAGGGTCCACACCGGGGAGAAGCCTTATG

AGTGTGGTGAGTGTGGCAAGGCCTTCTCTCAGAGCTCGGCACTGACAGTACACATTAGAAGCCACACGGGCGAGAAACCCTACGAATGTAAGGAATGCAG

AAAATCCTTCAGTCATAAGAAAAACTTCATCACCCACCAGAAAATCCATACTCGAGAGAAACCTTACGGATGCAATGAGTGTGGGAAAGCTTTTATCCAG

ATGTCAAACCTTGTCAGGCACCAGAGGATCCACACGGGAGAAAAACCTTATCTATGTAAGGAGTGTGGCAAAGCCTTCAGCCAGAAGTCAAATCTCATTG

CTCATGAAAAAATTCACTCTGGAGAGAAACCCTACGAGTGTAATGAGTGTGGGAAAGCCTTCAGCCAGAAGCAAAACTTCATCACCCATCAGAAAGTTCA

TACGGGAGAGAAACCTTACGATTGTAATAAATGTGGGAAAGCCTTTTCCCAGATCGCTTCCCTCACGCTTCATCTGCGAAGTCACACGGGAGAAAAGCCT

TACGAGTGTGAGAAGTGTGGGAAGGCCTTCTCCCAGTGCTCACTACTCAACTTACACATGAGAAGCCACACAGGGGAGAAGCCGTACGTGTGTAACGAGT

GCGGAAAAGCCTTCTCTCAAAGAACGTCCCTCATCGTGCATATGAGAGGCCATACCGGCGAGAAGCCCTATGAATGTAACAAGTGTGGGAAAGCTTTCTC

CCAGAGTTCCTCCCTCACTATCCACATCCGGGGTCACACGGGCGAGAAGCCCTTCGACTGCAGCAACTGTGGGAAAGCCTTCTCTCAGATCTCTTCTCTT

ACGCTTCACATGAGGAAACACACAGGCGAGAAGCCCTATGTCTGTATTGAGTGTGGAAAAGCTTTCAGCCAAAAGTCACACCTTGTCAGACACCAGAGAA

TCCACACTCACTAGAGACGCCGTGACCACGGTGAATGTGAGGACTGCCTCCCATTGAAGTGAACACCTCATAGCACGCGACACAATCAGTTCTGGCGCTG

ACTGTAGGAGAGCCTTGGGAAGGTCCCATGCATCTGTTAGACAATTCCCACTTCGGGGACCAATTGTATGAGAAACTGTCACCAAACACCCAGTGATATC

AGTATTCTCTTTCAAGTCTGAAAGAAAATATCTACTGTCAATCAACGAACTCGAGCTCCTTGCTGATGTATTAAGCAAGAGAAGGAGATTGGAAAAACCA

AAAACAATAACTTTTATAGGCAATATGAGACTATGGGGAAGTAGGTTTTGAATGATAATGTATGTGTCGGGAAGAAAGTCTAAGGTAATTAGGTGACATG

CGTACGAAGTTACAAAACGTGCTGACGAATGCAAAAGACCACTTGATAAAGCAAGTTAGAAAGTTATAAAAGTTCACGAACCCTTCCCAGTCTCTCCCTT

GTCCATACTTCCACTCAAAATTTACACATCAGTTATAAAGGATTTCATGAACTGATTTCAGAGTAATACGGCAAGGGAAAGGACCACAAATAGCAAAAAC

AAAAAATACAGCAAAAAACAAAACAACAACAAAAAACAGTTTTTAACAAAACAACTAGGGAAGATGTTCACTCTCTACTAGATTATAATTATTTAAAGTT

TTTCTTATTTAAACTCTTTTGAGTGAATAAACTTTTGGAAACAAATTGAAACCCAAGACTTGGCAATTTTCTATCTGCCTGGTGCTACTGAAATCATTGG

AATAAGTCTAGCCTGTTCAATATGTGTACAGGTTATGTGACCAAACTTGTTACTTCTTAAACAAAGATATACAGATTCCCTCAGGCTGGTGAGACGGCCC

CACTGATAGGGGTTTGCTGCCAAGCTTCACAGCTGACTACGATACCCAGAATCCACATGGTGGGTGGAAAGAACCAACTTCTACACTTGTCCTCTGACCT

CCAATGGCACGCCATGGTATGCATGTACACACACACACACACACACACACACACACACACACACTCAAAATAGGAAAGGTAAAATTCTAAAATGCTGGAA

ATAAAGTGAAACATGTTGCTTTAGCGTAAGAATATTAAAAAAAATAATAAACCCTGCAAACATGGAATAGTCTATTTTCTTTTAGTGTACTGGACTCAGA

AGTATCCATGTATGTCTGCAAAGATCTATCTATAAATGTTCCCAGATTTGTGGCTTGGTTTGCTCTAAGTGATATGTAACATTATCATTAATGCAGAGGT

GGATCAATATGTTTATTTCTATGATAGGACACTATTCTTTATTTAAAAGATACAAAATTCACATGTAGTTACATGGCTGGATCATGATATTTTGAGAGGA

AACCCCAAAATATTCAATTAACCATGGTATAATATTTGTAAGTTAATAAAACAGTTCAAAGAACA
Translation
 - UNI32608 - - UNI33340 -  - UNI32608 - - UNI33340 - - UNI34491 - MTESE - UNI2128 - - UNI13145 - - 

UNI34491 - GLVTFKDVAIDFTQEEWKQLDPTQRNLYRNVMLENYNNLITVG - UNI13034 - GPPLTKPEVIFKLEQEEEPCVVEREVLWRPCP

G GEILGIDEHQKIQDGQVFEGIVVTSEASECPEEFASTFFPNADSIPSMHSLFECDGVGECLEPNFGDDDVQYPLPEEQFEYDDAMQPFHTSSPHFVLT

PFKCNHCGKGFSQTLDLIRHLRVHTGGKLYECHQCGKGFSHKEKLINHHKLHSREQCYECSECGKTFIKMSNLIRHQRIHTGEKPYVCQECGKSFGQKSN

LIDHEKIHTGEKPYKCNECGKSFSQKQSLVAHQKVHTGEKPYACNECGKAFPRVASLALHMRGHTGEKPYKCDKCGKAFSQFSMLIIHVRVHTGEKPYEC

GECGKAFSQSSALTVHIRSHTGEKPYECKECRKSFSHKKNFITHQKIHTREKPYGCNECGKAFIQMSNLVRHQRIHTGEKPYLCKECGKAFSQKSNLIAH

EKIHSGEKPYECNECGKAFSQKQNFITHQKVHTGEKPYDCNKCGKAFSQIASLTLHLRSHTGEKPYECEKCGKAFSQCSLLNLHMRSHTGEKPYVCNECG

KAFSQRTSLIVHMRGHTGEKPYECNKCGKAFSQSSSLTIHIRGHTGEKPFDCSNCGKAFSQISSLTLHMRKHTGEKPYVCIECGKAFSQKSHLVRHQRIH

TH
Transcript ENSMUST00000032797
Sequence
ACAAAATAGAAAACCTGGTGATGAGCCACAGATAGCACCAGAGTTCTGCCCGCATTTAGTTCTGTGCCGGAACAGAACCAACAATTGAAAACACAGAAGT

GCATCTTCTCACAACGTCAACAAG - UNI2128 - - UNI33340 - - UNI34491 - CTTGCTCAGGACCTCCCCCCTAAAAAGAAGAGGAAAT

GACCGAGTCTGAG - UNI2128 - - UNI13145 - - UNI34491 - GGACTAGTGACGTTCAAAGACGTGGCCATTGATTTTACCCAAGAAGAA

TGGAAGCAACTGGATCCTACTCAGCGGAACCTATATAGGAATGTGATGCTAGAAAACTACAACAACTTAATCACAGTAG - UNI13034 - GCCCGCC

ACTCACCAAACCTGAAGTGATTTTCAAGTTGGAGCAAGAGGAAGAGCCTTGTGTGGTGGAGAGAGAAGTGCTGTGGAGACCCTGTCCAG GGGAGATTTT

GGGAATTGACGAGCACCAGAAAATCCAGGACGGACAAGTTTTCGAGGGAATAGTGGTGACGAGTGAAGCCAGCGAATGTCCGGAGGAATTTGCAAGTACG

TTTTTCCCAAACGCAGACTCCATTCCTTCCATGCACAGTCTCTTTGAATGTGACGGTGTTGGAGAGTGTTTAGAGCCCAATTTTGGTGATGATGATGTAC

AATACCCGTTGCCAGAGGAACAGTTTGAATATGACGATGCTATGCAGCCATTTCACACCAGCTCGCCCCATTTTGTGCTGACCCCCTTTAAGTGCAACCA

TTGTGGAAAAGGCTTTAGTCAGACCCTGGACCTCATCAGACACCTGAGAGTTCACACAGGGGGGAAGCTCTATGAATGCCACCAGTGTGGGAAAGGCTTT

AGCCACAAGGAGAAGCTGATCAACCATCATAAGCTCCATAGCAGGGAGCAGTGTTACGAGTGTAGCGAGTGCGGGAAGACTTTCATCAAGATGTCAAATC

TCATTAGACATCAAAGGATCCACACTGGGGAGAAGCCGTATGTGTGCCAGGAATGTGGGAAATCCTTCGGCCAGAAGTCCAATCTCATTGATCACGAAAA

AATTCACACTGGAGAGAAGCCTTACAAATGTAACGAATGTGGAAAATCCTTCAGCCAGAAACAAAGCCTTGTCGCACATCAGAAAGTTCACACTGGGGAG

AAGCCTTACGCGTGCAACGAGTGTGGGAAAGCCTTCCCTCGCGTGGCTTCCCTTGCTCTGCATATGAGGGGCCACACAGGGGAGAAGCCATACAAGTGTG

ATAAGTGTGGGAAAGCCTTCTCTCAGTTTTCCATGCTCATCATACACGTGAGGGTCCACACCGGGGAGAAGCCTTATGAGTGTGGTGAGTGTGGCAAGGC

CTTCTCTCAGAGCTCGGCACTGACAGTACACATTAGAAGCCACACGGGCGAGAAACCCTACGAATGTAAGGAATGCAGAAAATCCTTCAGTCATAAGAAA

AACTTCATCACCCACCAGAAAATCCATACTCGAGAGAAACCTTACGGATGCAATGAGTGTGGGAAAGCTTTTATCCAGATGTCAAACCTTGTCAGGCACC

AGAGGATCCACACGGGAGAAAAACCTTATCTATGTAAGGAGTGTGGCAAAGCCTTCAGCCAGAAGTCAAATCTCATTGCTCATGAAAAAATTCACTCTGG

AGAGAAACCCTACGAGTGTAATGAGTGTGGGAAAGCCTTCAGCCAGAAGCAAAACTTCATCACCCATCAGAAAGTTCATACGGGAGAGAAACCTTACGAT

TGTAATAAATGTGGGAAAGCCTTTTCCCAGATCGCTTCCCTCACGCTTCATCTGCGAAGTCACACGGGAGAAAAGCCTTACGAGTGTGAGAAGTGTGGGA

AGGCCTTCTCCCAGTGCTCACTACTCAACTTACACATGAGAAGCCACACAGGGGAGAAGCCGTACGTGTGTAACGAGTGCGGAAAAGCCTTCTCTCAAAG

AACGTCCCTCATCGTGCATATGAGAGGCCATACCGGCGAGAAGCCCTATGAATGTAACAAGTGTGGGAAAGCTTTCTCCCAGAGTTCCTCCCTCACTATC

CACATCCGGGGTCACACGGGCGAGAAGCCCTTCGACTGCAGCAACTGTGGGAAAGCCTTCTCTCAGATCTCTTCTCTTACGCTTCACATGAGGAAACACA

CAGGCGAGAAGCCCTATGTCTGTATTGAGTGTGGAAAAGCTTTCAGCCAAAAGTCACACCTTGTCAGACACCAGAGAATCCACACTCACTAG
Translation
 - UNI2128 - - UNI33340 - - UNI34491 - MTESE - UNI2128 - - UNI13145 - - UNI34491 - GLVTFKDVAIDFTQEEW

KQLDPTQRNLYRNVMLENYNNLITVG - UNI13034 - GPPLTKPEVIFKLEQEEEPCVVEREVLWRPCPG GEILGIDEHQKIQDGQVFEGIVVTSE

ASECPEEFASTFFPNADSIPSMHSLFECDGVGECLEPNFGDDDVQYPLPEEQFEYDDAMQPFHTSSPHFVLTPFKCNHCGKGFSQTLDLIRHLRVHTGGK

LYECHQCGKGFSHKEKLINHHKLHSREQCYECSECGKTFIKMSNLIRHQRIHTGEKPYVCQECGKSFGQKSNLIDHEKIHTGEKPYKCNECGKSFSQKQS

LVAHQKVHTGEKPYACNECGKAFPRVASLALHMRGHTGEKPYKCDKCGKAFSQFSMLIIHVRVHTGEKPYECGECGKAFSQSSALTVHIRSHTGEKPYEC

KECRKSFSHKKNFITHQKIHTREKPYGCNECGKAFIQMSNLVRHQRIHTGEKPYLCKECGKAFSQKSNLIAHEKIHSGEKPYECNECGKAFSQKQNFITH

QKVHTGEKPYDCNKCGKAFSQIASLTLHLRSHTGEKPYECEKCGKAFSQCSLLNLHMRSHTGEKPYVCNECGKAFSQRTSLIVHMRGHTGEKPYECNKCG

KAFSQSSSLTIHIRGHTGEKPFDCSNCGKAFSQISSLTLHMRKHTGEKPYVCIECGKAFSQKSHLVRHQRIHTH
Transcript ENSMUST00000078457
Sequence
ATGACCGAGTCTGAG - UNI2128 - - UNI13145 - - UNI34491 - GGACTAGTGACGTTCAAAGACGTGGCCATTGATTTTACCCAAGAAG

AATGGAAGCAACTGGATCCTACTCAGCGGAACCTATATAGGAATGTGATGCTAGAAAACTACAACAACTTAATCACAGTAG - UNI13034 - GCCCG

CCACTCACCAAACCTGAAGTGATTTTCAAGTTGGAGCAAGAGGAAGAGCCTTGTGTGGTGGAGAGAGAAGTGCTGTGGAGACCCTGTCCAG GGGAGATT

TTGGGAATTGACGAGCACCAGAAAATCCAGGACGGACAAGTTTTCGAGGGAATAGTGGTGACGAGTGAAGCCAGCGAATGTCCGGAGGAATTTGCAAGTA

CGTTTTTCCCAAACGCAGACTCCATTCCTTCCATGCACAGTCTCTTTGAATGTGACGGTGTTGGAGAGTGTTTAGAGCCCAATTTTGGTGATGATGATGT

ACAATACCCGTTGCCAGAGGAACAGTTTGAATATGACGATGCTATGCAGCCATTTCACACCAGCTCGCCCCATTTTGTGCTGACCCCCTTTAAGTGCAAC

CATTGTGGAAAAGGCTTTAGTCAGACCCTGGACCTCATCAGACACCTGAGAGTTCACACAGGGGGGAAGCTCTATGAATGCCACCAGTGTGGGAAAGGCT

TTAGCCACAAGGAGAAGCTGATCAACCATCATAAGCTCCATAGCAGGGAGCAGTGTTACGAGTGTAGCGAGTGCGGGAAGACTTTCATCAAGATGTCAAA

TCTCATTAGACATCAAAGGATCCACACTGGGGAGAAGCCGTATGTGTGCCAGGAATGTGGGAAATCCTTCGGCCAGAAGTCCAATCTCATTGATCACGAA

AAAATTCACACTGGAGAGAAGCCTTACAAATGTAACGAATGTGGAAAATCCTTCAGCCAGAAACAAAGCCTTGTCGCACATCAGAAAGTTCACACTGGGG

AGAAGCCTTACGCGTGCAACGAGTGTGGGAAAGCCTTCCCTCGCGTGGCTTCCCTTGCTCTGCATATGAGGGGCCACACAGGGGAGAAGCCATACAAGTG

TGATAAGTGTGGGAAAGCCTTCTCTCAGTTTTCCATGCTCATCATACACGTGAGGGTCCACACCGGGGAGAAGCCTTATGAGTGTGGTGAGTGTGGCAAG

GCCTTCTCTCAGAGCTCGGCACTGACAGTACACATTAGAAGCCACACGGGCGAGAAACCCTACGAATGTAAGGAATGCAGAAAATCCTTCAGTCATAAGA

AAAACTTCATCACCCACCAGAAAATCCATACTCGAGAGAAACCTTACGGATGCAATGAGTGTGGGAAAGCTTTTATCCAGATGTCAAACCTTGTCAGGCA

CCAGAGGATCCACACGGGAGAAAAACCTTATCTATGTAAGGAGTGTGGCAAAGCCTTCAGCCAGAAGTCAAATCTCATTGCTCATGAAAAAATTCACTCT

GGAGAGAAACCCTACGAGTGTAATGAGTGTGGGAAAGCCTTCAGCCAGAAGCAAAACTTCATCACCCATCAGAAAGTTCATACGGGAGAGAAACCTTACG

ATTGTAATAAATGTGGGAAAGCCTTTTCCCAGATCGCTTCCCTCACGCTTCATCTGCGAAGTCACACGGGAGAAAAGCCTTACGAGTGTGAGAAGTGTGG

GAAGGCCTTCTCCCAGTGCTCACTACTCAACTTACACATGAGAAGCCACACAGGGGAGAAGCCGTACGTGTGTAACGAGTGCGGAAAAGCCTTCTCTCAA

AGAACGTCCCTCATCGTGCATATGAGAGGCCATACCGGCGAGAAGCCCTATGAATGTAACAAGTGTGGGAAAGCTTTCTCCCAGAGTTCCTCCCTCACTA

TCCACATCCGGGGTCACACGGGCGAGAAGCCCTTCGACTGCAGCAACTGTGGGAAAGCCTTCTCTCAGATCTCTTCTCTTACGCTTCACATGAGGAAACA

CACAGGCGAGAAGCCCTATGTCTGTATTGAGTGTGGAAAAGCTTTCAGCCAAAAGTCACACCTTGTCAGACACCAGAGAATCCACACTCACTAGAGACGC

CGTGACCACGGTGAATGTGAGGACTGCCTCCCATTGAAGTGAACACCTCATAGCACGCGACACAATCAGTTCTGGCGCTGACTGTAGGAGAGCCTTGGGA

AGGTCCCATGCATCTGTTAGACAATTCCCACTTCGGGGACCAATTGTATGAGAAACTGTCACCAAACACCCAGTGATATCAGTATTCTCTTTCAAGTCTG

AAAGAAAATATCTACTGTCAATCAACGAACTCGAGCTCCTTGCTGATGTATTAAGCAAGAGAAGGAGATTGGAAAAACCAAAAACAATAACTTTTATAGG

CAATATGAGACTATGGGGAAGTAGGTTTTGAATGATAATGTATGTGTCGGGAAGAAAGTCTAAGGTAATTAGGTGACATGCGTACGAAGTTACAAAACGT

GCTGACGAATGCAAAAGACCACTTGATAAAGCAAGTTAGAAAGTTATAAAAGTTCACGAACCCTTCCCAGTCTCTCCCTTGTCCATACTTCCACTCAAAA

TTTACACATCAGTTATAAAGGATTTCATGAACTGATTTCAGAGTAATACGGCAAGGGAAAGGACCACAAATAGCAAAAACAAAAAATACAGCAAAAAACA

AAACAACAACAAAAAACAGTTTTTAACAAAACAACTAGGGAAGATGTTCACTCTCTACTAGATTATAATTATTTAAAGTTTTTCTTATTTAAACTCTTTT

GAGTGAATAAACTTTTGGAAACAAATTGAAACCCAAGACTTGGCAATTTTCTATCTGCCTGGTGCTACTGAAATCATTGGAATAAGTCTAGCCTGTTCAA

TATGTGTACAGGTTATGTGACCAAACTTGTTACTTCTTAAACAAAGATATACAGATTCCCTCAGGCTGGTGAGACGGCCCCACTGATAGGGGTTTGCTGC

CAAGCTTCACAGCTGACTACGATACCCAGAATCCACATGGTGGGTGGAAAGAACCAACTTCTACACTTGTCCTCTGACCTCCAATGGCACGCCATGGTAT

GCATGTACACACACACACACACACACACACACACACACACACACTCAAAATAGGAAAGGTAAAATTCTAAAATGCTGGAAATAAAGTGAAACATGTTGCT

TTAGCGTAAGAATATTAAAAAAAATAATAAACCCTGCAAACATGGAATAGTCTATTTTCTTTTAGTGTACTGGACTCAGAAGTATCCATGTATGTCTGCA

AAGATCTATCTATAAATGTTCCCAGATTTGTGGCTTGGTTTGCTCTAAGTGATATGTAACATTATCATTAATGCAGAGGTGGATCAATATGTTTATTTCT

ATGATAGGACACTATTCTTTATTTAAAAGATACAAAATTCACATGTAGTTACATGGCTGGATCATGATATTTTGAGAGGAAACCCCAAAATATTCAATTA

ACCATGGTATAATATTTGTAAGTTAATAAAACAGTTC
Translation
MTESE - UNI2128 - - UNI13145 - - UNI34491 - GLVTFKDVAIDFTQEEWKQLDPTQRNLYRNVMLENYNNLITVG - UNI13034 -

 GPPLTKPEVIFKLEQEEEPCVVEREVLWRPCPG GEILGIDEHQKIQDGQVFEGIVVTSEASECPEEFASTFFPNADSIPSMHSLFECDGVGECLEPNF

GDDDVQYPLPEEQFEYDDAMQPFHTSSPHFVLTPFKCNHCGKGFSQTLDLIRHLRVHTGGKLYECHQCGKGFSHKEKLINHHKLHSREQCYECSECGKTF

IKMSNLIRHQRIHTGEKPYVCQECGKSFGQKSNLIDHEKIHTGEKPYKCNECGKSFSQKQSLVAHQKVHTGEKPYACNECGKAFPRVASLALHMRGHTGE

KPYKCDKCGKAFSQFSMLIIHVRVHTGEKPYECGECGKAFSQSSALTVHIRSHTGEKPYECKECRKSFSHKKNFITHQKIHTREKPYGCNECGKAFIQMS

NLVRHQRIHTGEKPYLCKECGKAFSQKSNLIAHEKIHSGEKPYECNECGKAFSQKQNFITHQKVHTGEKPYDCNKCGKAFSQIASLTLHLRSHTGEKPYE

CEKCGKAFSQCSLLNLHMRSHTGEKPYVCNECGKAFSQRTSLIVHMRGHTGEKPYECNKCGKAFSQSSSLTIHIRGHTGEKPFDCSNCGKAFSQISSLTL

HMRKHTGEKPYVCIECGKAFSQKSHLVRHQRIHTH
Transcript ENSMUST00000108211
Sequence
GGGATCCTTTCGGATTCTTCTCAGTTGCAAGTTGCACCCCCAGGCTGTGAATGCCAGGCCGCGGGGTAGCCGCTGCTACAAAACCCGCCCAGGCTCAAGC

CGGTCCCCCTGCCGCAGCGCCGCGCCCTTACCCGAGCCTTGGCCACTCTCCTGACTCGCACGCCGAAGGCCAGACCCGCCCGGCGAGCCGCGCGGCCCTC

TGGGAAGTGCTACCCTGCGCCTAGCGGACCCAG - UNI32608 - - UNI33340 - - UNI34491 - TTCAGCTTGCTCAGGACCTCCCCCCTA

AAAAGAAGAGGAAATGACCGAGTCTGAG - UNI2128 - - UNI13145 - - UNI34491 - GGACTAGTGACGTTCAAAGACGTGGCCATTGAT

TTTACCCAAGAAGAATGGAAGCAACTGGATCCTACTCAGCGGAACCTATATAGGAATGTGATGCTAGAAAACTACAACAACTTAATCACAGTAG - UNI

13034 - GCCCGCCACTCACCAAACCTGAAGTGATTTTCAAGTTGGAGCAAGAGGAAGAGCCTTGTGTGGTGGAGAGAGAAGTGCTGTGGAGACCCTGT

CCAG GGGAGATTTTGGGAATTGACGAGCACCAGAAAATCCAGGACGGACAAGTTTTCGAGGGAATAGTGGTGACGAGTGAAGCCAGCGAATGTCCGGAG

GAATTTGCAA TTATGGTTGGATCTGGGATGTTTCCCCCAAAGAAGGTCCCCAAAACAACAATGTTCAGAACTGATCTGGTCACGAGGGTTCTGACCTCG

TCAAAGCTGAATCTACTTACGGATTCCTAGCGGATACCAAAAG ACATTCTTGTCATAGTACCAGAAAGCTGTCTGTCTCACTCGTCAGAACCTTTATCG

GGATAATGCCAACCAACAGCATAAACCATTTGAGGCTAGTTCAAAAAAAAAAAATTGAAGCATTTATCTTCAACATAGCTCCTTTCCCAGTTGAAAGTAG

TAGAAAAACAAAAGGCAATACTTGTTGGAATAATTGACTCTCAATTTAAAATGTAAGGTCCCGTTGCGTTTGGGCTGCAGTCGAAGAGAAAGAAGAAAAG

GAACTGTGCACACGGTCTCTCAAGCCAGGGGCCAGCGTGAGCACCAGAGCGCTGGTGGATCTCAGCAGAGCTTTTTGAGTGTCTAGCTCGATTCCTTGTT

TTCTTTTTAAATTATTGTGTGTGGGGGTGGTGGGGGTGGTGATGGTTTTGTGGATTGTGTTGAAACACCTCTGTAGACCAGGCTGGGCTCAGACTCATGG

CCTCTAACCTTCTGAGTGCTGGGTTTGCAGGCATGTGCTGCCATAATACCAGTTTCTGGATTTTTAAACAGAAA
Translation
 - UNI32608 - - UNI33340 - - UNI34491 - MTESE - UNI2128 - - UNI13145 - - UNI34491 - GLVTFKDVAIDFTQEE

WKQLDPTQRNLYRNVMLENYNNLITVG - UNI13034 - GPPLTKPEVIFKLEQEEEPCVVEREVLWRPCPG GEILGIDEHQKIQDGQVFEGIVVTS

EASECPEEFAI IMVGSGMFPPKKVPKTTMFRTDLVTRVLTSSKLNLLTDS 
Transcript ENSMUST00000108212
Sequence
ACAAAATAGAAAACCTGGTGATGAGCCACAGATAGCACCAGAGTTCTGCCCGCATTTAGTTCTGTGCCGGAACAGAACCAACAATTGAAAACACAGAAGT

GCATCTTCTCACAACGTCAACAAG - UNI2128 - - UNI33340 - - UNI34491 - CTTGCTCAGGACCTCCCCCCTAAAAAGAAGAGGAAAT

GACCGAGTCTGAG - UNI2128 - - UNI13145 - - UNI34491 - GGACTAGTGACGTTCAAAGACGTGGCCATTGATTTTACCCAAGAAGAA

TGGAAGCAACTGGATCCTACTCAGCGGAACCTATATAGGAATGTGATGCTAGAAAACTACAACAACTTAATCACAGTAG - UNI13034 - GCCCGCC

ACTCACCAAACCTGAAGTGATTTTCAAGTTGGAGCAAGAGGAAGAGCCTTGTGTGGTGGAGAGAGAAGTGCTGTGGAGACCCTGTCCAG GGGAGATTTT

GGGAATTGACGAGCACCAGAAAATCCAGGACGGACAAGTTTTCGAGGGAATAGTGGTGACGAGTGAAGCCAGCGAATGTCCGGAGGAATTTGCAA TTAT

GGTTGGATCTGGGATGTTTCCCCCAAAGAAGGTCCCCAAAACAACAATGTTCAGAACTGATCTGGTCACGAGGGTTCTGACCTCGTCAAAGCTGAATCTA

CTTACGGATTCCTAGCGGATACCAAAAG ACATTCTTGTCATAGTACCAGAAAGCTGTCTGTCTCACTCGTCAGAACCTTTATCGGGATAATGCCAACCA

ACAGCATAAACCATTTGAGGCTAGTTCAAAAAAAAAAAATTGAAGCATTTATCTTCAACATAGCTCCTTTCCCAGTTGAAAGTAGTAGAAAAACAAAAGG

CAATACTTGTTGGAATAATTGACTCTCAATTTAAAATGTAAGGTCCCGTTGCGTTTGGGCTGCAGTCGAAGAGAAAGAAGAAAAGGAACTGTGCACACGG

TCTCTCAAGCCAGGGGCCAGCGTGAGCACCAGAGCGCTGGTGGATCTCAGCAGAGCTTTTTGAGTGTCTAGCTCGATTCCTTGTTTTCTTTTTAAATTAT

TGTGTGTGGGGGTGGTGGGGGTGGTGATGGTTTTGTGGATTGTGTTGAAACACCTCTGTAGACCAGGCTGGGCTCAGACTCATGGCCTCTAACCTTCTGA

GTGCTGGGTTTGCAGGCATGTGCTGCCATAATACCAGTTTCTGGATTTTTAAACAGAAAGGCGTGTCTTGGCGATTTCTGTGCCAGGTGAAGGCCAGGTA

CAGGTAAAAAGCTCGCTTCTAGCTGTTGGCATGAGTTTTGCATGGGTCCTATAGGAAGAAGGCTGGGTATTCAAACCTGCACTGTAATTCAGGCACTGCA

GGATTAAGACTCTGGCTTCGGTTTTCATATACTTCAGCTCTGCAGCTATTCGTTTTTCAAAGCAGACACAGAAATGCCCGTGACATCAGCACTGTGCTGA

GCCAGCAACCTGAAGCCCTGAGGTCATGCTTTCTTCCCTGCTTTGTCCAGCACTTTATCAGTCTTTCTCACGATATTCTACTCACAGGCTTGAGTAAAAC

GGGCTAAGATGTTAGATACATGGTTACCCAGAATCTTGCCTTAGAACAAGTCAGAACAGCCTTAATTAGGAATTCCAATGGTGCTACTTGCATGTCCTCT

GACACATCATTCCATGGGCTCCCCATGTCCTCTGTGTCACTGGAAATGGTCATAGTGCCTTTAAAGTACACCACACCAGAGACTTAAGAAAGCTTTCAAA

TGCTGTTCTCCTGGCCATTCTTTTTTTTTTTTTTTTTAAAGATTTATTTATTATTATATCTAAATACACTATAGCTGTCTCTTCAGACACACCAGAAGAG

GGCGTCAGATCTTATTAAAGATGGTTGTGAGCCACCATGTGGTTGCTGAGATTTGAACTCATGACCTTTGGAAGAGCAGTCAGTGCTCTTACCCGCTGAG

TCATCTCTCTAGCCCCTCTCTAGGCCATTCTTGTTCCCAGAGTATCAGTCAGGATTCTCCAATAGGACACTCATCCATATATGTATGCTACATGTAACTT

AGATGTTACATGTTACATATTAAATGTACGTGCAAAATATAATTATTTAACAAGT
Translation
 - UNI2128 - - UNI33340 - - UNI34491 - MTESE - UNI2128 - - UNI13145 - - UNI34491 - GLVTFKDVAIDFTQEEW

KQLDPTQRNLYRNVMLENYNNLITVG - UNI13034 - GPPLTKPEVIFKLEQEEEPCVVEREVLWRPCPG GEILGIDEHQKIQDGQVFEGIVVTSE

ASECPEEFAI IMVGSGMFPPKKVPKTTMFRTDLVTRVLTSSKLNLLTDS 

For any suggestions or comments, please send an email to unitrap@crg.es