Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000059981 (Taok2)
Chromosomal location
Chr 7: 134009911 - 134028217 (-)
Description
TAO kinase 2 Gene [Source:MGI (curated);Acc:Taok2-001]
UniGene
Mm.259634 
MGI
MGI:1915919 
Uniprot/SWISSPROT
Q6ZQ29 
Uniprot/SPTREMBL
Q3V3V4 
Human Ortholog
ENSG00000149930 (TAOK2)
Omim not available
UniTrap UNI24337
Vector Insertion
Chr 7: 134024010 - 134024178
Public Clones not available
Private Clones OST224437 (lexicon) OST207189 (lexicon) OST42626 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31026
Vector Insertion
Chr 7: 134024010 - 134028186
Public Clones (sanger) IST14726B8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000071268
Sequence
AAGAGAGAGAGGGAGAGAGAGGGAGGCCGGGACGAGAGCAGGGCTGTGGTGCGGTGAGAAGCTGAGACGAAAAGGAAAGGGAGTGAGGCACAGGGACCAT

CAGCAGCGCCTCCGCTACAGTCCTTCAGCTGTTCCGGAGAGAGAGGACGGGAAAGGGAGTAGGCCAGGGCTGGAGTAGGGGCTGTCACTCTCGGACCCCA

GCCTTAGAGGGGCCGTGCAGCCGGGCGTCCTCGGGGTGGGCCCCTTGTCGTGGCCGAAGACCTGGGGCTCAGGCCCCTGGGTCCCAAATTTTGGGGCTTG

GTCCCTTGTTTCTCAGATACCCAGGTATCAAACCCTCGTATATCAGATATCTGGGACCCAAAGTCCCAACCTTTACAAACCTGGGTCTCTGTTTTATAGA

ATTTAAAATACCTGGGATTCAGGACCCTGTGTGCACCAATATCCGGGGTTCATCCTCCAAGCGATCAGATATCGGACTCATTTTTAGCCCTTGCAAATAT

ACGGGGCTCAGACCCCACAATCGGAAATCCGGGATTCAGCAACTGTCGCCCTCGAGTTGGGGGAGGACTGGACCGCGAGGTCAGATCAGGTTGTCACCCC

CTCCCCTCCAGGGGAGGCTTCCCGGGCCCGCCCCTCAGGAAGGGCGAAAGCTGAGGAAGAGGTGGCGAGGGGGAAGGTCTCCTTGCCCCTCTCCCTGCTT

GTCAGAGCAACTGGAGTACCCCAGGCGGAAGCGGAGGCGCTGGGGCACCATAGTGACCCCTACCAG - UNI24337 - - UNI31026 - GCAAGAT

CCCAATCTCAGGGCCCCCTGGGGCCATCATGCCAGCTGGGGGCCGGGCCGGGAGCCTGAAGGACCCTGATGTGGCTGAGCTCTTCTTCAAGGATGACCCT

GAGAAGCTCTTCTCTGACCTCCGGGAGATCGGCCATGGCAGCTTTGGAGCAGTGTACTTT - UNI24337 - - UNI31026 - GCCCGGGATGTCC

GGAACAGTGAGGTGGTGGCCATCAAGAAGATGTCCTATAGTGGGAAGCAATCAAATGAG AAATGGCAGGATATCATCAAGGAAGTGCGGTTCTTACAGA

AGCTACGGCATCCTAATACCATTCAGTACCGGGGCTGTTACCTGAGGGAGCACACAGCTTGG CTGGTGATGGAGTATTGCCTGGGCTCAGCTTCTGATC

TTCTAGAAG TGCACAAGAAACCCCTGCAGGAGGTAGAGATTGCAGCTGTGACCCATGGGGCTCTTCAGGGCCTGGCATATCTACACTCACACAACATGA

TCCATAG AGATGTGAAGGCTGGAAACATCTTGCTGTCAGAACCAGGCTTGGTAAAACTGGGGGACTTTGGCTCTGCGTCAATCATGGCACCTGCCAACT

CTTTTGTGGGTACTCCATACTG GATGGCTCCAGAGGTGATCCTAGCCATGGATGAGGGACAATATGATGGCAAAGTGGATGTCTGGTCCTTGGGGATAA

CCTGTATTGAGCTAG CGGAGCGGAAGCCACCACTGTTCAACATGAATGCAATGAGTGCCTTATACCACATTGCACAGAATGAATCTCCTGCTCTCCAGT

CAGGACACTG GTCTGAGTACTTCCGGAATTTTGTTGACTCCTGTCTTCAGAAAATCCCTCAAGACAGACCAACCTCAGAGGTTCTTTTGAAG CACCGC

TTTGTGCTCCGGGAGCGACCGCCCACAGTCATCATGGACCTAATCCAGAGGACCAAGGATGCTGTACGGGAACTGGATAACCTGCAGTACCGAAAGATGA

AGAAGATACTGTTCCAAGAGGCACCCAATGGCCCTGGTGCTGAGGCCCCAGAGGAAGAGGAG CTCACACCCTGTTCCCAGGAGGCAGAACCTTACACGC

ACCGTGCAGGGACACTGACCAGTCTAGAGAGCAGCCATTCAGTGCCCAGCATGTCCATCAGCGCCTCCAGCCAGAGCAGCTCAGTCAACAGCCTAGCAGA

TGCCTCAGATAATGAAGAAGAGGAGGAAGAAGAAGAGGAAGAGGAGGAGGAGGAGGAGGAAGAAGGCCCTGAATCCAGAGAGATGGCCATGATGCAGGAG

GGGGAGCATACAGTCACTTCCCACAGCTCCATCATCCACCGGCTGCCG GGCTCAGACAACCTATATGATGATCCCTACCAGCCAGAGATGACCCCAGGT

CCACTCCAGCCACCTGCAGCCCCTCCCACCTCCACCTCCTCTTCTGCTCGCCGCAGAGCTTATTGCCGCAACCGAGACCACTTTGCTACCATTCGTACTG

CCTCCCTG GTCAGCCGTCAGATCCAGGAGCATGAGCAGGACTCAGCCCTGCGAGAGCAGCTGAGTGGCTACAAGCGGATGCGACGTCAGCACCAGAAGC

AACTGCTGGCCCTGGAGTCCCGTCTGAGGGGTGAACGTGAGGAGCACAGTGGGCGGTTACAGCGGGAGCTCGAGGCACAGCGGGCTGGCTTTGGGACCGA

GGCTGAGAAGCTGGCCCGGAGGCACCAGGCCATTGGTGAGAAGGAGGCACGGGCTGCTCAGGCGGAGGAGCGGAAGTTCCAGCAGCACATCCTGGGGCAG

CAGAAGAAGGAGCTGGCCGCCCTGCTGGAGGCGCAGAAGCGAACCTACAAGCTGCGGAAGGAGCAGTTGAAAGAG GAGCTCCAGGAGAACCCTAGCACA

CCCAAACGAGAGAAGGCTGAGTGGCTGTTGAGGCAAAAGGAGCAGTTGCAACAGTGCCAGGCAGAAGAGGAAGCGGGGCTGCTGCGGAGGCAGCGCCAGT

ACTTTGAACTTCAGTGTCGCCAATACAAGCGCAAGATGCTACTGGCTCGGCACAGCCTAGATCAGGACCTGCTTCGAGAG GACTTGAATAAGAAACAGA

CACAGAAGGACTTGGAGTGTGCTCTGCTGTTACGGCAGCATGAGGCTACCCGAGAGCTGGAGCTAAGACAGCTCCAGGCTGTCCAGCGCACACGTGCTGA

ACTTACCCGCCTTCAGCACCAGACAGAACTAGGCAACCAGCTGGAGTACAACAAGCGACGGGAGCAAGAATTACGGCAGAAGCACGCGGCCCAGGTTCGC

CAGCAGCCCAAGAGCCTCAAA TCAAAGGAGCTGCAGATCAAGAAGCAGTTCCAGGAGACGTGTAAGATCCAGACGCGGCAATACAAGGCTCTTCGGGCA

CACTTGCTGGAGACCACACCCAAAGCTCAGCACAAGAGCCTTCTTAAGCGGCTCAAGGAGGAGCAGACCCGCAAGCTGGCGATCCTGGCTGAGCAGTATG

ACCAGTCCATTTCAGAGATGCTCAGCTCGCAGGCG CTCCGGCTTGATGAGACCCAAGAGGCAGAGTTTCAGGCCCTGCGGCAGCAGCTCCAGCAGGAGC

TGGAGCTCCTCAACGCTTACCAGAGCAAGATCAAGATCCGCACAGAGAGCCAGCATGAGCGGGAGCTGAGGGAGCTGGAGCAGAGAGTAGCTCTGAGGCG

GGCACTGCTAGAGCAACGG GTGGAAGAAGAGCTGCTGGCCCTACAGACAGGCCGTTCGGAACGTATCCGGAGTTTGCTTGAGCGGCAGGCCCGTGAGAT

CGAGGCCTTCGATGCTGAGAGCATGAGACTGGGCTTCTCCAGCATGGCTCTGGGGGGCATTCCAGCTGAAGCTGCGGCCCAGGGCTATCCTGCTCCACCC

CCCGCCCCTGCCTGGCCCTCCCGTCCAGTTCCCCGTTCAGGGGCCCATTGGAGCCATGGCCCTCCTCCACCAGGCATGCCCCCACCAGCTTGGCGTCAGC

CAGCTCTGCTGGCTCCCCCAGGGCCTCCAAACTGGTTAGGGCCCCCAACACAGAGTGGAACACCCCGTGGAGGGGCTCTGCTGCTGCTAAGAAACAGTCC

TCAACCCCTAAGGCGGGCAGCGTCAGGGGGCAGCAGTGGTGAGAACGTCGGCCCACCTGCTGCAGTGCCAGGGCCGCTGAGCCGAAGCACCAGTGTTGCT

TCCCACATCCTCAACGGCTCCTCCCACTTCTATTCCTGA
Translation
 - UNI24337 - - UNI31026 - MPAGGRAGSLKDPDVAELFFKDDPEKLFSDLREIGHGSFGAVYF - UNI24337 - - UNI31026 - AR

DVRNSEVVAIKKMSYSGKQSNE KWQDIIKEVRFLQKLRHPNTIQYRGCYLREHTAW LVMEYCLGSASDLLEV VHKKPLQEVEIAAVTHGALQGLAYL

HSHNMIHR RDVKAGNILLSEPGLVKLGDFGSASIMAPANSFVGTPYW WMAPEVILAMDEGQYDGKVDVWSLGITCIELA AERKPPLFNMNAMSALYH

IAQNESPALQSGHW WSEYFRNFVDSCLQKIPQDRPTSEVLLK HRFVLRERPPTVIMDLIQRTKDAVRELDNLQYRKMKKILFQEAPNGPGAEAPEEEE

 LTPCSQEAEPYTHRAGTLTSLESSHSVPSMSISASSQSSSVNSLADASDNEEEEEEEEEEEEEEEEEGPESREMAMMQEGEHTVTSHSSIIHRLP GSD

NLYDDPYQPEMTPGPLQPPAAPPTSTSSSARRRAYCRNRDHFATIRTASL VSRQIQEHEQDSALREQLSGYKRMRRQHQKQLLALESRLRGEREEHSGR

LQRELEAQRAGFGTEAEKLARRHQAIGEKEARAAQAEERKFQQHILGQQKKELAALLEAQKRTYKLRKEQLKE ELQENPSTPKREKAEWLLRQKEQLQQ

CQAEEEAGLLRRQRQYFELQCRQYKRKMLLARHSLDQDLLRE DLNKKQTQKDLECALLLRQHEATRELELRQLQAVQRTRAELTRLQHQTELGNQLEYN

KRREQELRQKHAAQVRQQPKSLK SKELQIKKQFQETCKIQTRQYKALRAHLLETTPKAQHKSLLKRLKEEQTRKLAILAEQYDQSISEMLSSQA LRLD

ETQEAEFQALRQQLQQELELLNAYQSKIKIRTESQHERELRELEQRVALRRALLEQR VEEELLALQTGRSERIRSLLERQAREIEAFDAESMRLGFSSM

ALGGIPAEAAAQGYPAPPPAPAWPSRPVPRSGAHWSHGPPPPGMPPPAWRQPALLAPPGPPNWLGPPTQSGTPRGGALLLLRNSPQPLRRAASGGSSGEN

VGPPAAVPGPLSRSTSVASHILNGSSHFYS
Transcript ENSMUST00000117394
Sequence
TCCCGCCCGGTCTCCATCTTGGAATTGGGAGGAAGAGAGAGAGGGAGAGAGAGGGAGGCCGGGACGAGAGCAGGGCTGTGGTGCGGTGAGAAGCTGAGAC

GAAAAGGAAAGGGAGTGAGGCACAGGGACCATCAGCAGCGCCTCCGCTACAGTCCTTCAGCTGTTCCGGAGAGAGAGGACGGGAAAGGGAGTAGGCCAGG

GCTGGAGTAGGGGCTGTCACTCTCGGACCCCAGCCTTAGAGGGGCCGTGCAGCCGGGCGTCCTCGGGGTGGGCCCCTTGTCGTGGCCGAAGACCTGGGGC

TCAGGCCCCTGGGTCCCAAATTTTGGGGCTTGGTCCCTTGTTTCTCAGATACCCAGGTATCAAACCCTCGTATATCAGATATCTGGGACCCAAAGTCCCA

ACCTTTACAAACCTGGGTCTCTGTTTTATAGAATTTAAAATACCTGGGATTCAGGACCCTGTGTGCACCAATATCCGGGGTTCATCCTCCAAGCGATCAG

ATATCGGACTCATTTTTAGCCCTTGCAAATATACGGGGCTCAGACCCCACAATCGGAAATCCGGGATTCAGCAACTGTCGCCCTCGAGTTGGGGGAGGAC

TGGACCGCGAGGTCAGATCAGGTTGTCACCCCCTCCCCTCCAGGGGAGGCTTCCCGGGCCCGCCCCTCAGGAAGGGCGAAAGCTGAGGAAGAGGTGGCGA

GGGGGAAGGTCTCCTTGCCCCTCTCCCTGCTTGTCAGAGCAACTGGAGTACCCCAGGCGGAAGCGGAGGCGCTGGGGCACCATAGTGACCCCTACCAG -

 UNI24337 - - UNI31026 - GCAAGATCCCAATCTCAGGGCCCCCTGGGGCCATCATGCCAGCTGGGGGCCGGGCCGGGAGCCTGAAGGACCCTG

ATGTGGCTGAGCTCTTCTTCAAGGATGACCCTGAGAAGCTCTTCTCTGACCTCCGGGAGATCGGCCATGGCAGCTTTGGAGCAGTGTACTTT - UNI24

337 - - UNI31026 - GCCCGGGATGTCCGGAACAGTGAGGTGGTGGCCATCAAGAAGATGTCCTATAGTGGGAAGCAATCAAATGAG AAATGGCA

GGATATCATCAAGGAAGTGCGGTTCTTACAGAAGCTACGGCATCCTAATACCATTCAGTACCGGGGCTGTTACCTGAGGGAGCACACAGCTTGG CTGGT

GATGGAGTATTGCCTGGGCTCAGCTTCTGATCTTCTAGAAG TGCACAAGAAACCCCTGCAGGAGGTAGAGATTGCAGCTGTGACCCATGGGGCTCTTCA

GGGCCTGGCATATCTACACTCACACAACATGATCCATAG AGATGTGAAGGCTGGAAACATCTTGCTGTCAGAACCAGGCTTGGTAAAACTGGGGGACTT

TGGCTCTGCGTCAATCATGGCACCTGCCAACTCTTTTGTGGGTACTCCATACTG GATGGCTCCAGAGGTGATCCTAGCCATGGATGAGGGACAATATGA

TGGCAAAGTGGATGTCTGGTCCTTGGGGATAACCTGTATTGAGCTAG CGGAGCGGAAGCCACCACTGTTCAACATGAATGCAATGAGTGCCTTATACCA

CATTGCACAGAATGAATCTCCTGCTCTCCAGTCAGGACACTG GTCTGAGTACTTCCGGAATTTTGTTGACTCCTGTCTTCAGAAAATCCCTCAAGACAG

ACCAACCTCAGAGGTTCTTTTGAAG CACCGCTTTGTGCTCCGGGAGCGACCGCCCACAGTCATCATGGACCTAATCCAGAGGACCAAGGATGCTGTACG

GGAACTGGATAACCTGCAGTACCGAAAGATGAAGAAGATACTGTTCCAAGAGGCACCCAATGGCCCTGGTGCTGAGGCCCCAGAGGAAGAGGAG CTCAC

ACCCTGTTCCCAGGAGGCAGAACCTTACACGCACCGTGCAGGGACACTGACCAGTCTAGAGAGCAGCCATTCAGTGCCCAGCATGTCCATCAGCGCCTCC

AGCCAGAGCAGCTCAGTCAACAGCCTAGCAGATGCCTCAGATAATGAAGAAGAGGAGGAAGAAGAAGAGGAAGAGGAGGAGGAGGAGGAGGAAGAAGGCC

CTGAATCCAGAGAGATGGCCATGATGCAGGAGGGGGAGCATACAGTCACTTCCCACAGCTCCATCATCCACCGGCTGCCG GGCTCAGACAACCTATATG

ATGATCCCTACCAGCCAGAGATGACCCCAGGTCCACTCCAGCCACCTGCAGCCCCTCCCACCTCCACCTCCTCTTCTGCTCGCCGCAGAGCTTATTGCCG

CAACCGAGACCACTTTGCTACCATTCGTACTGCCTCCCTG GTCAGCCGTCAGATCCAGGAGCATGAGCAGGACTCAGCCCTGCGAGAGCAGCTGAGTGG

CTACAAGCGGATGCGACGTCAGCACCAGAAGCAACTGCTGGCCCTGGAGTCCCGTCTGAGGGGTGAACGTGAGGAGCACAGTGGGCGGTTACAGCGGGAG

CTCGAGGCACAGCGGGCTGGCTTTGGGACCGAGGCTGAGAAGCTGGCCCGGAGGCACCAGGCCATTGGTGAGAAGGAGGCACGGGCTGCTCAGGCGGAGG

AGCGGAAGTTCCAGCAGCACATCCTGGGGCAGCAGAAGAAGGAGCTGGCCGCCCTGCTGGAGGCGCAGAAGCGAACCTACAAGCTGCGGAAGGAGCAGTT

GAAAGAG GAGCTCCAGGAGAACCCTAGCACACCCAAACGAGAGAAGGCTGAGTGGCTGTTGAGGCAAAAGGAGCAGTTGCAACAGTGCCAGGCAGAAGA

GGAAGCGGGGCTGCTGCGGAGGCAGCGCCAGTACTTTGAACTTCAGTGTCGCCAATACAAGCGCAAGATGCTACTGGCTCGGCACAGCCTAGATCAGGAC

CTGCTTCGAGAG GACTTGAATAAGAAACAGACACAGAAGGACTTGGAGTGTGCTCTGCTGTTACGGCAGCATGAGGCTACCCGAGAGCTGGAGCTAAGA

CAGCTCCAGGCTGTCCAGCGCACACGTGCTGAACTTACCCGCCTTCAGCACCAGACAGAACTAGGCAACCAGCTGGAGTACAACAAGCGACGGGAGCAAG

AATTACGGCAGAAGCACGCGGCCCAGGTTCGCCAGCAGCCCAAGAGCCTCAAAGTACGTGCAGGCCAGCTACCCATGGGCCTCCCTGCTACTGGGGCTCT

GGGACCACTCAGCACAGGCACCCCTAGTGAAGAGCAGCCTTGCTCATCTGGCCAGGAGGCAATCCTGGACCAAAGGATGCTGGGAGAGGAGGAGGAAGCA

GTGCCAGAGAGAAGGATTCTGGGAAAGGAAGGGACTACCTTGGAGCCAGAGGAGCAGAGGATTCTGGGGGAAGAAATGGGAACCTTTAGTTCCAGCCCAC

AAAAACATAGGAGTCTGGCTAATGAGGAAGATTGGGATATATCTGAGGAGATGAAGGAGATTAGAGTCCCATCACTGGCATCCCAGGAGAGAAATATTAT

TGGCCAGGAAGAGGCAGCGGCATGGAGTCTGTGGGAGAAGGAGGGTGGGAACCTTGTGGATGTGGAGTTCAAGCTTGGCTGGGTCCAGGGTCCAGTTCTG

ACTCCAGTCCCGGAGGAGGAAGAGGAGGAGGAAGAAGAGGGAGGGGCTCCAATTGGAACCCACAGGGACCCTGGAGATGGCTGTCCTTCCCCAGATATCC

CCCCAGAGCCACCTCCATCACATCTGAGACAGTACCCTACTAGCCAGCTCCCTGGACTCCTGTCTCATGGCCTCCTGGCTGGCCTATCCTTTGCAGTGGG

GTCCTCCTCTGGCCTCCTGCCCCTACTCCTCCTGCTGCTACTCCCATTGCTGGCAGCCCAGGGTGGAGGTGGCTTGCAGGCAGCACTGCTGGCCCTTGAG

GTAGGGCTAGTGGGCCTGGGGGCCTCCTACCTGTTCCTTTGTACAGCTCTACACCTGCCCCCCGGTCTGTTCTTACTCCTGGCTCAGGGTACTGCACTGT

TGGCTGTCCTTAGCCTGAGCTGGCGCAGAGGCCTTATGGGTGTGCCTCTGGGCCTTGGGGCTGCCTGGCTCCTAGCTTGGCCCAGCCTGGCTTTACCTCT

GGCAGCTATGGCAGCTGGGGGCAAATGGGTACGGCAACAAGGCCCCCAGATGCGTCGGGGTATCTCTCGACTCTGGTTGAGGATTTTGCTACGCCTGTCA

CCCATGGTCTTTCGGGCCCTACAGGGCTGTGGGGCTGTAGGAGACCGGGGGCTGTTTGCCCTGTACCCTAAGACCAATAAGAATGGTTTCCGAAGTCGAC

TACCTGTCCCTTGGCCCCGTCAGGGAAATCCTCGCACTACTCAACACCCCCTAGCTCAGTTAACAAGAGTTTGGGCTGTGTGCAAGGGCTGGAACTGGCG

CCTAGCACGGGCTAGCCACAGATTAGCTTCTTGCTTGCCCCCCTGGGCTGTTCATATACTAGCCAGCTGGGGCCTGCTTAAGGGTGAACGGCCTAGTCGG

ATCCCTCGGCTGCTGCCACGCAGCCAACGCCGTCTTGGGCTCTCTGCTTCCCGACAGCTACCACCAGGGACTGTAGCTGGGCGGAGATCTCAGACTCGCA

GGACCCTGCCTCCCTGGAGGTAACCAGTTCCAATTCTCCACCCAAATTTAGGGCACTGAGCACTTTATCTCCCATGACTCAGTAAAGTTTCTCCAGTCTC

CCAGCCTCTCCTCCCCTTCTGACCTTTCTTCCTCAGTATGTTTTCCCAAGTCCAATCCCGGCCCCAGATCTAGGTTTTTAGACAGGCAGCCTCCTCTGCT

ATGGAGTCCAGAAATGACACTCTTTGTGTTTTCCCCAGTCCCCTAAGTTATTGCTGTCCCCTGCTGTGTGTGCTCATCCTCACCCTCATTGGCTCAGGCC

TGGGGCCAGGGGTGGCAGGGATGGAAGTCATGGGGGTTTTCCCTCTTTGATTTTGTTTTTCTGTCTCCCTTCCAACCTGTCCCCTTCCCCTCCACCAAAA

AAGAAAAAAAAAAAAAAAAGAAAAACACAAATAAAATATCTGAGCGGAACTA
Translation
 - UNI24337 - - UNI31026 - MPAGGRAGSLKDPDVAELFFKDDPEKLFSDLREIGHGSFGAVYF - UNI24337 - - UNI31026 - AR

DVRNSEVVAIKKMSYSGKQSNE KWQDIIKEVRFLQKLRHPNTIQYRGCYLREHTAW LVMEYCLGSASDLLEV VHKKPLQEVEIAAVTHGALQGLAYL

HSHNMIHR RDVKAGNILLSEPGLVKLGDFGSASIMAPANSFVGTPYW WMAPEVILAMDEGQYDGKVDVWSLGITCIELA AERKPPLFNMNAMSALYH

IAQNESPALQSGHW WSEYFRNFVDSCLQKIPQDRPTSEVLLK HRFVLRERPPTVIMDLIQRTKDAVRELDNLQYRKMKKILFQEAPNGPGAEAPEEEE

 LTPCSQEAEPYTHRAGTLTSLESSHSVPSMSISASSQSSSVNSLADASDNEEEEEEEEEEEEEEEEEGPESREMAMMQEGEHTVTSHSSIIHRLP GSD

NLYDDPYQPEMTPGPLQPPAAPPTSTSSSARRRAYCRNRDHFATIRTASL VSRQIQEHEQDSALREQLSGYKRMRRQHQKQLLALESRLRGEREEHSGR

LQRELEAQRAGFGTEAEKLARRHQAIGEKEARAAQAEERKFQQHILGQQKKELAALLEAQKRTYKLRKEQLKE ELQENPSTPKREKAEWLLRQKEQLQQ

CQAEEEAGLLRRQRQYFELQCRQYKRKMLLARHSLDQDLLRE DLNKKQTQKDLECALLLRQHEATRELELRQLQAVQRTRAELTRLQHQTELGNQLEYN

KRREQELRQKHAAQVRQQPKSLKVRAGQLPMGLPATGALGPLSTGTPSEEQPCSSGQEAILDQRMLGEEEEAVPERRILGKEGTTLEPEEQRILGEEMGT

FSSSPQKHRSLANEEDWDISEEMKEIRVPSLASQERNIIGQEEAAAWSLWEKEGGNLVDVEFKLGWVQGPVLTPVPEEEEEEEEEGGAPIGTHRDPGDGC

PSPDIPPEPPPSHLRQYPTSQLPGLLSHGLLAGLSFAVGSSSGLLPLLLLLLLPLLAAQGGGGLQAALLALEVGLVGLGASYLFLCTALHLPPGLFLLLA

QGTALLAVLSLSWRRGLMGVPLGLGAAWLLAWPSLALPLAAMAAGGKWVRQQGPQMRRGISRLWLRILLRLSPMVFRALQGCGAVGDRGLFALYPKTNKN

GFRSRLPVPWPRQGNPRTTQHPLAQLTRVWAVCKGWNWRLARASHRLASCLPPWAVHILASWGLLKGERPSRIPRLLPRSQRRLGLSASRQLPPGTVAGR

RSQTRRTLPPWR

For any suggestions or comments, please send an email to unitrap@crg.es