Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000060090 (Rp2h)
Chromosomal location
Chr X: 19941607 - 19982781 (+)
Description
retinitis pigmentosa 2 homolog (human) Gene [Source:MGI (curated);Acc:Rp2h-001]
RefSeq_dna
NM_133669 
RefSeq_peptide
NP_598430.1 
UniGene
Mm.288141 Mm.406805 Mm.409016 
MGI
MGI:1277953 
Uniprot/SWISSPROT
Q9EPK2 
Uniprot/SPTREMBL
B1B077 B1B076 
Human Ortholog
ENSG00000102218 (RP2)
Omim 312600 - RETINITIS PIGMENTOSA 2  
UniTrap UNI34429
Vector Insertion
Chr X: 19942325 - 19954006
Public Clones IST12439H2 (tigm) IST10875G9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34742
Vector Insertion
Chr X: 19958946 - 19974346
Public Clones IST13968F4 (tigm) IST15086F6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 82% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33657
Vector Insertion
Chr X: 19977984 - 19981174
Public Clones IST12738D2 (tigm) IST12444H7 (tigm) IST12742A5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000115387
Sequence
GGGGGTTGGGCGGAGAAGGGTGTTGGGCCTGGCGGGAGTGCTGAGGGTTCCTGGCGGCGGGGCTGCTCCCCTGGGCGGTGTCCGGGGAGCTGTTGGCCGA

GTCACCCTGGCTTCCCGCCACCCTCTGAAAGGTGTCTGAGCGAGTGGGGTCCACTACCAAGACCCTTAGGCCGCACCATGGGCTGCTGCTTCACTAAGAG

GAGGAAGAGTGAAAAGGCTGAGGGAGAGGAGGAGCAGCCCAAGCTGTACAGCTGGGACCAGCGGGAGAAG GCTCTGCACCCCGACTCCGGATTCTAGAA

AGGACTCCAGGGAGGGAAAGAGCCAGGAAGGTGCTGAATCTCCAATCAGCTCATTTCACCAGCGTTGGCCAAAGGGGTTTGGTCCAGTGGTCGAATTACA

CACGCAAGACTGGTTCTCATCTTTTCTGCG - UNI34429 - GTTGATCCAAAAGATTACATGTTTAGTGGACTGAAGGATGAAACAGTAGGTCGCTT

ACCTGGAAAAGTGGCAGGACAACAATTTGTCATTCAAGACTGTGAGAACTGTAACATCTATATTTTTGACCACTCAGCTACTATTACCATTGATGACTGC

ACTAACTGTGTAATTTTTTTGGGACCAGTGAAAGGCAGTGTCTTTTTCCGAAATTGTAGAGATTGCAAGTGCACATTGGCTTGCCAGCAATTTCGTGTGA

GAGACTGTAGAAAGTTGGAAGTCTTTTTGTGCTGTGCTACTCAACCCATTATTGAATCTTCCACAAACATCAAGTTTGGCTGTTTTCAATGGTACTACCC

TGAATTAGCAGCCCAATTCAAAGATGCAGGCCTCAGTATCTTCAATAACATTTGGAGTCATGTTCATGATTTTACACCTGTGTCAGGAGAGCTCAACTGG

AGCCTTCTTCCAGAAAATGCCGTGGTTCAAGACTATGTTCCTATCCCAATGACTGAAGAATTCAAAGCTGTGCGAATTTCCACAGAAGCCAATAGAAGCA

TTGTTCCTGTGTCCCGGGGTCAGAGACAGAAGTACAGTGATGAATCATGTCTTGTGGTATTATTTGCCGATGATTATACAACTGCAAATGCCAGGAAACT

AATTGATGAG ATGGTTGGTAAAGGCTTCTCCCTAGTGCAGACAAAGGAAATGTCAATGAAAACTGAAGACGCCCAAAGGGTTTTCCAGGAAAAGGCATC

AGATTTTTTACTTCTTCTAAACAAAG - UNI34742 - GTCCTGTGATTGCCTTGGAATTTAATGGAGATGACGCTGTACAAGAATGTCACCTTATTG

TAAATGGGATGTTCAACGGGACAAAG ATGTTTGTATCAGAAAAGAAGGAGACCGCATCTGGAGATGTTGATAGCTTCTATAACTTTGCTGAGATCCAGA

TGGGGATATGAAGCGGATTGTGGTATTAAGCCCCTTCCATCCTTTATATACAGACAGTTTGATAATATCCTTACATATGTTAGTCATTTAGCAATTAGTA

ATTTTTACTAATGCTATAATTGTTAAAAGCTATTTTTAAATAACTCTTTGAATACCATATTATTTACTTGAGTATCTAAAATAATTCATTTAAATTGAGT

AGTTTTAATCATAAACTATTTAACTTGCTTCAGTAAGCTTGCAGTTTTATTTCTTTTCATACAATAGTCTTATTAGGAAATAATCATGATTTTATTCCTA

ATTAAAAGTTCTTTCATATCTCTGGTAATTTAAACTTTCCAACTTACCTTAGTGCTCTATGATAATTCATTTAAGAATATATTTTGTTTCTTATTTTCTC

TTTTAATTTAGAGGCATTTGTTACTAGGTGAAATTAAATAAACCTATGCACTTTAAAAAAATACATACATAGCCAGTTAAATAATCATTTCCTTCTTGCA

TTATATGACTAATGAGATTTTGTACATGGAGTTGACATACTATTTTGTAAATTGGGAGATTTTTTTAAAATGGGTATTTGAAAGCTGAATGTGGTCATGG

CATATGTAGTCCCAGGCTACTTGGGATGCCTAAGTGGAAGAATCACTTGAGTTCAGGAGTTCAAGAACAGCTTTGGCAAGTAAGAAAAGGCTAAGATAAC

CAGCTTTGCAAATACTTCTAACTGATCCTGGCATTGCTGGTTTAAGGACTACTTCCAAGTAGTACAGCTGATTTCTAAGCACAACTGCCAGATGATTCTC

CTGTTTTCTAATAAGAAAAAGTTAGATACAACATAAAACTATAGAACACCAATGACCAAGCAGGGCGTGGTGGCACACGCCTTTAATGCCAGCACTGGGG

AGGCAGAGGCAGGCTGATTTCTGAGTTTGAGGCCAGCCTGGTCTACAGAGTGAGTTCCAGGACAGCCAGGGCTATACAGAGAAACCCTGTCTCGAAAAAC

AAAACAAAACAAAAGAACACCAATGAGCAACAGATTTGACAGAGGTGATCAGTGTCTGTGACTAGCTATTGTGACTAGCAAGAGACCTAGAGCAAATCTT

ATAAGTAAGGAATCTTTTAAGTAAGGAACACTTAGGTATGATGATAATCTAGACAGGTTATTCAAAATCTCCATCCATTTTTTTTTTTTGCTCATGTCAA

CTAGTGTTAAAGTATGATAAAAGTTTTGGTTACTTGAAATCATTATTTCTCAATTCTATTTGATAATAGTAACTTCCAGGAGGAGGAATGGGAATTGTTC

AGAAATACACATTGATGGATCCAGTCTAAAGGTGCACAGATTCAGTTTTCAAGGGAAACTGAAATAGGGTGTATTGTTATCTAAACTAATCAGTTCTGAA

AGTGCTGATAGGGCGATTTTATCATATTTGGCAGGGAGCAAGAACAGCTTTCATAGGCTCATTTATAGGACTCAAAATGGAAACTTTTATTTTTATAAAA

CTGAGATTGAAAATGGCCACTTGTAAAAATTCCTTCCATGGTTGTTACCAAAAGTGTATTTTCCTGTTTAAAGTGGTTTTGGAAACTTTCAGGCCAACTT

ATAACTATCATGTTGAATTGTAAATGTGTAGAAATAATGCTTTTTTATTTTGAATTAATAATATTGAGTACCTACACTGTGCCTAGCCTACCATCAGCAT

TTCAACATTTCTTTTATTATAAGAGCATCATGTTCTACAGAGTCAATATGATCTCATAAGGTGCAAATAAAAACTGCTGGCAGGGCAGGTATAATAATTT

CTATCATAGTTTACAAATGGTCTTTGCAAATAGTGATCAGAGGCATTAACGTTTCCCTGAGCTAAGCTAAATTAAATGCATTCTTTTCTGCCTTGATTAT

ATTACTAATTTTCTTTACCCACATTTGAAATAATCTCAATACTTGCTATTTCAAAACTAAAATGCAATGTTATAGGGGGTATACATTGAGTTTTTAATCG

TATCAATAATGGTGTGTAAAAACTCAAGAATATTATATAAAGGAGACATTAATTTAAGATTTTCCCACCAAATTTAGTATGTTAACCAAAACCTAAAACT

TTATATCCATTTAGATGGGAACTTTTTACAAGTACTTTTATGTTGTTTCTGCAAGTCTAGACTTCAATAGTAATCATGATATACTAACTATATTTTATTT

CTGAATAGTTTTTTAAATTCATGAAAAATTAATAGCCATGAAAACTGATTTTATTGTCATATTTGTTTAAGCATCTTATTAGTTTACTTCTCTTGCATTA

ATAGTACTGCTATATTTTGGGTCTGTATATTTATATGTGGCATTTATAAAATTATCTAGTGTTTTAAAAATACTTTGAAATAAATATTAAAATTAAAATG

GTTCAATGCTACTTTTTTGAAGAGTACTCTATATTTACTCATACTTGTACCAAAATTTGATAAAATTTTTATTTTCTTTTGGGTGTTTTGTTATACAACT

TTTAATTTTAAAAACAAAATAAAGTGGTCTAATCTCTGTTTTATACTAATGAGAAATGAACTGTTAAACTGCGTGTGTATGTATTTGATGTATATATGTG

CATGTGTATATACACAAGGTACTCTAAAGAAATGAAAAGGAAGAAACATATTTTGATATAAGGAATTTACATCATGTTTTCTTTGCTAAAATAAGTCACA

TTTTGTTATGGGTGAATATTTGCTAAGATTAGGCATCTTTCCTTCCATATTTTAAAAATATGCTGGGTATAGCATATACAATTGTAATTCTAGTACTCAG

GAATTCAAGGCCAGCCTAGGTTATATATTGAATTCCAGGCCAGTCTGGGCTATATAGCAAGAGCCTGCCTCAAAAAATAAAGAAGTGTGATAAATTTTCA

TTCAGGCTTATAAAAGTAGATGGTATTTTTTATTGTCAAGTTTACCAGTCTTTGTCCTCCTTTCCTATCTCACAAAACAAATACTGAAAGTGCAAATTGG

TTTGTTTGTAAAAAGATAACATTATGTTTATTTCTACTTATAAAGGTTCAACAAGTACATTAAGAACATTTGGAGCATTGAGAACAAGCAGAAATGATAA

CACAATAATAAAATTGCTTCCTGTTGGAT
Translation
  - UNI34429 - MFSGLKDETVGRLPGKVAGQQFVIQDCENCNIYIFDHSATITIDDCTNCVIFLGPVKGSVFFRNCRDCKCTLACQQFRVRDCRKL

EVFLCCATQPIIESSTNIKFGCFQWYYPELAAQFKDAGLSIFNNIWSHVHDFTPVSGELNWSLLPENAVVQDYVPIPMTEEFKAVRISTEANRSIVPVSR

GQRQKYSDESCLVVLFADDYTTANARKLIDE MVGKGFSLVQTKEMSMKTEDAQRVFQEKASDFLLLLNKG - UNI34742 - GPVIALEFNGDDAVQ

ECHLIVNGMFNGTK MFVSEKKETASGDVDSFYNFAEIQMGI
Transcript ENSMUST00000067979
Sequence
AGGGTGTTGGGCCTGGCGGGAGTGCTGAGGGTTCCTGGCGGCGGGGCTGCTCCCCTGGGCGGTGTCCGGGGAGCTGTTGGCCGAGTCACCCTGGCTTCCC

GCCACCCTCTGAAAGGTGTCTGAGCGAGTGGGGTCCACTACCAAGACCCTTAGGCCGCACCATGGGCTGCTGCTTCACTAAGAGGAGGAAGAGTGAAAAG

GCTGAGGGAGAGGAGGAGCAGCCCAAGCTGTACAGCTGGGACCAGCGGGAGAAG - UNI34429 - GTTGATCCAAAAGATTACATGTTTAGTGGACT

GAAGGATGAAACAGTAGGTCGCTTACCTGGAAAAGTGGCAGGACAACAATTTGTCATTCAAGACTGTGAGAACTGTAACATCTATATTTTTGACCACTCA

GCTACTATTACCATTGATGACTGCACTAACTGTGTAATTTTTTTGGGACCAGTGAAAGGCAGTGTCTTTTTCCGAAATTGTAGAGATTGCAAGTGCACAT

TGGCTTGCCAGCAATTTCGTGTGAGAGACTGTAGAAAGTTGGAAGTCTTTTTGTGCTGTGCTACTCAACCCATTATTGAATCTTCCACAAACATCAAGTT

TGGCTGTTTTCAATGGTACTACCCTGAATTAGCAGCCCAATTCAAAGATGCAGGCCTCAGTATCTTCAATAACATTTGGAGTCATGTTCATGATTTTACA

CCTGTGTCAGGAGAGCTCAACTGGAGCCTTCTTCCAGAAAATGCCGTGGTTCAAGACTATGTTCCTATCCCAATGACTGAAGAATTCAAAGCTGTGCGAA

TTTCCACAGAAGCCAATAGAAGCATTGTTCCTGTGTCCCGGGGTCAGAGACAGAAGTACAGTGATGAATCATGTCTTGTGGTATTATTTGCCGATGATTA

TACAACTGCAAATGCCAGGAAACTAATTGATGAG ATGGTTGGTAAAGGCTTCTCCCTAGTGCAGACAAAGGAAATGTCAATGAAAACTGAAGACGCCCA

AAGGGTTTTCCAGGAAAAGGCATCAGATTTTTTACTTCTTCTAAACAAAG - UNI34742 - GTCCTGTGATTGCCTTGGAATTTAATGGAGATGACG

CTGTACAAGAATGTCACCTTATTGTAAATGGGATGTTCAACGGGACAAAG ATCCCTTAA
Translation
MGCCFTKRRKSEKAEGEEEQPKLYSWDQREK - UNI34429 - VDPKDYMFSGLKDETVGRLPGKVAGQQFVIQDCENCNIYIFDHSATITIDDCTNC

VIFLGPVKGSVFFRNCRDCKCTLACQQFRVRDCRKLEVFLCCATQPIIESSTNIKFGCFQWYYPELAAQFKDAGLSIFNNIWSHVHDFTPVSGELNWSLL

PENAVVQDYVPIPMTEEFKAVRISTEANRSIVPVSRGQRQKYSDESCLVVLFADDYTTANARKLIDE MVGKGFSLVQTKEMSMKTEDAQRVFQEKASDF

LLLLNKG - UNI34742 - GPVIALEFNGDDAVQECHLIVNGMFNGTK IP
Transcript ENSMUST00000115391
Sequence
AGAGCAGCTTGCGAGGCATTGATTGGCTCAGAGGCTGCTGCCCGCTTATTGGTTGCCATAGGTCGTCACGGAGACCTAGGGGGTTGGGCGGAGAAGGGTG

TTGGGCCTGGCGGGAGTGCTGAGGGTTCCTGGCGGCGGGGCTGCTCCCCTGGGCGGTGTCCGGGGAGCTGTTGGCCGAGTCACCCTGGCTTCCCGCCACC

CTCTGAAAGGTGTCTGAGCGAGTGGGGTCCACTACCAAGACCCTTAGGCCGCACCATGGGCTGCTGCTTCACTAAGAGGAGGAAGAGTGAAAAGGCTGAG

GGAGAGGAGGAGCAGCCCAAGCTGTACAGCTGGGACCAGCGGGAGAAG - UNI34429 - GTTGATCCAAAAGATTACATGTTTAGTGGACTGAAGGA

TGAAACAGTAGGTCGCTTACCTGGAAAAGTGGCAGGACAACAATTTGTCATTCAAGACTGTGAGAACTGTAACATCTATATTTTTGACCACTCAGCTACT

ATTACCATTGATGACTGCACTAACTGTGTAATTTTTTTGGGACCAGTGAAAGGCAGTGTCTTTTTCCGAAATTGTAGAGATTGCAAGTGCACATTGGCTT

GCCAGCAATTTCGTGTGAGAGACTGTAGAAAGTTGGAAGTCTTTTTGTGCTGTGCTACTCAACCCATTATTGAATCTTCCACAAACATCAAGTTTGGCTG

TTTTCAATGGTACTACCCTGAATTAGCAGCCCAATTCAAAGATGCAGGCCTCAGTATCTTCAATAACATTTGGAGTCATGTTCATGATTTTACACCTGTG

TCAGGAGAGCTCAACTGGAGCCTTCTTCCAGAAAATGCCGTGGTTCAAGACTATGTTCCTATCCCAATGACTGAAGAATTCAAAGCTGTGCGAATTTCCA

CAGAAGCCAATAGAAGCATTGTTCCTGTGTCCCGGGGTCAGAGACAGAAGTACAGTGATGAATCATGTCTTGTGGTATTATTTGCCGATGATTATACAAC

TGCAAATGCCAGGAAACTAATTGATGAG ATGGTTGGTAAAGGCTTCTCCCTAGTGCAGACAAAGGAAATGTCAATGAAAACTGAAGACGCCCAAAGGGT

TTTCCAGGAAAAGGCATCAGATTTTTTACTTCTTCTAAACAAAG - UNI34742 - GTCCTGTGATTGCCTTGGAATTTAATGGAGATGACGCTGTAC

AAGAATGTCACCTTATTGTAAATGGGATGTTCAACGGGACAAAG ATGTTTGTATCAGAAAAGAAGGAGACCGCATCTGGAGATGTTGATAGCTTCTATA

ACTTTGCTGAGATCCAGATGGGGATATGAAGCGGATTGTG GTTCAACAAGTACATTAAGAACATTTGGAGCATTGAGAACAAGCAGAAATGATAACACA

ATAATAAAATTGCTTCCTGTTGGATATTT
Translation
MGCCFTKRRKSEKAEGEEEQPKLYSWDQREK - UNI34429 - VDPKDYMFSGLKDETVGRLPGKVAGQQFVIQDCENCNIYIFDHSATITIDDCTNC

VIFLGPVKGSVFFRNCRDCKCTLACQQFRVRDCRKLEVFLCCATQPIIESSTNIKFGCFQWYYPELAAQFKDAGLSIFNNIWSHVHDFTPVSGELNWSLL

PENAVVQDYVPIPMTEEFKAVRISTEANRSIVPVSRGQRQKYSDESCLVVLFADDYTTANARKLIDE MVGKGFSLVQTKEMSMKTEDAQRVFQEKASDF

LLLLNKG - UNI34742 - GPVIALEFNGDDAVQECHLIVNGMFNGTK MFVSEKKETASGDVDSFYNFAEIQMGI 
Transcript ENSMUST00000033372
Sequence
GGGCGGAGAAGGGTGTTGGGCCTGGCGGGAGTGCTGAGGGTTCCTGGCGGCGGGGCTGCTCCCCTGGGCGGTGTCCGGGGAGCTGTTGGCCGAGTCACCC

TGGCTTCCCGCCACCCTCTGAAAGGTGTCTGAGCGAGTGGGGTCCACTACCAAGACCCTTAGGCCGCACCATGGGCTGCTGCTTCACTAAGAGGAGGAAG

AGTGAAAAGGCTGAGGGAGAGGAGGAGCAGCCCAAGCTGTACAGCTGGGACCAGCGGGAGAAG - UNI34429 - GTTGATCCAAAAGATTACATGTT

TAGTGGACTGAAGGATGAAACAGTAGGTCGCTTACCTGGAAAAGTGGCAGGACAACAATTTGTCATTCAAGACTGTGAGAACTGTAACATCTATATTTTT

GACCACTCAGCTACTATTACCATTGATGACTGCACTAACTGTGTAATTTTTTTGGGACCAGTGAAAGGCAGTGTCTTTTTCCGAAATTGTAGAGATTGCA

AGTGCACATTGGCTTGCCAGCAATTTCGTGTGAGAGACTGTAGAAAGTTGGAAGTCTTTTTGTGCTGTGCTACTCAACCCATTATTGAATCTTCCACAAA

CATCAAGTTTGGCTGTTTTCAATGGTACTACCCTGAATTAGCAGCCCAATTCAAAGATGCAGGCCTCAGTATCTTCAATAACATTTGGAGTCATGTTCAT

GATTTTACACCTGTGTCAGGAGAGCTCAACTGGAGCCTTCTTCCAGAAAATGCCGTGGTTCAAGACTATGTTCCTATCCCAATGACTGAAGAATTCAAAG

CTGTGCGAATTTCCACAGAAGCCAATAGAAGCATTGTTCCTGTGTCCCGGGGTCAGAGACAGAAGTACAGTGATGAATCATGTCTTGTGGTATTATTTGC

CGATGATTATACAACTGCAAATGCCAGGAAACTAATTGATGAG ATGGTTGGTAAAGGCTTCTCCCTAGTGCAGACAAAGGAAATGTCAATGAAAACTGA

AGACGCCCAAAGGGTTTTCCAGGAAAAGGCATCAGATTTTTTACTTCTTCTAAACAAAG - UNI34742 - GTCCTGTGATTGCCTTGGAATTTAATG

GAGATGACGCTGTACAAGAATGTCACCTTATTGTAAATGGGATGTTCAACGGGACAAAG ATGTTTGTATCAGAAAAGAAGGAGACCGCATCTGGAGATG

TTGATAGCTTCTATAACTTTGCTGAGATCCAGATGGGGATATGAAGCGGATTGTGGTATTAAGCCCCTTCCATCCTTTATATACAGACAGTTTGATAATA

TCCTTACATATGTTAGTCATTTAGCAATTAGTAATTTTTACTAATGCTATAATTGTTAAAAGCTATTTTTAAATAACTCTTTGAATACCATATTATTTAC

TTGAGTATCTAAAATAATTCATTTAAATTGAGTAGTTTTAATCATAAACTATTTAACTTGCTTCAGTAAGCTTGCAGTTTTATTTCTTTTCATACAATAG

TCTTATTAGGAAATAATCATGATTTTATTCCTAATTAAAAGTTCTTTCATATCTCTGGTAATTTAAACTTTCCAACTTACCTTAGTGCTCTATGATAATT

CATTTAAGAATATATTTTGTTTCTTATTTTCTCTTTTAATTTAGAGGCATTTGTTACTAGGTGAAATTAAATAAACCTATGCACTTTAAAAAAATACATA

CATAGCCAGTTAAATAATCATTTCCTTCTTGCATTATATGACTAATGAGATTTTGTACATGGAGTTGACATACTATTTTGTAAATTGGGAGATTTTTTTA

AAATGGGTATTTGAAAGCTGAATGTGGTCATGGCATATGTAGTCCCAGGCTACTTGGGATGCCTAAGTGGAAGAATCACTTGAGTTCAGGAGTTCAAGAA

CAGCTTTGGCAAGTAAGAAAAGGCTAAGATAACCAGCTTTGCAAATACTTCTAACTGATCCTGGCATTGCTGGTTTAAGGACTACTTCCAAGTAGTACAG

CTGATTTCTAAGCACAACTGCCAGATGATTCTCCTGTTTTCTAATAAGAAAAAGTTAGATACAACATAAAACTATAGAACACCAATGACCAAGCAGGGCG

TGGTGGCACACGCCTTTAATGCCAGCACTGGGGAGGCAGAGGCAGGCTGATTTCTGAGTTTGAGGCCAGCCTGGTCTACAGAGTGAGTTCCAGGACAGCC

AGGGCTATACAGAGAAACCCTGTCTCGAAAAACAAAACAAAACAAAAGAACACCAATGAGCAACAGATTTGACAGAGGTGATCAGTGTCTGTGACTAGCT

ATTGTGACTAGCAAGAGACCTAGAGCAAATCTTATAAGTAAGGAATCTTTTAAGTAAGGAACACTTAGGTATGATGATAATCTAGACAGGTTATTCAAAA

TCTCCATCCATTTTTTTTTTTTGCTCATGTCAACTAGTGTTAAAGTATGATAAAAGTTTTGGTTACTTGAAATCATTATTTCTCAATTCTATTTGATAAT

AGTAACTTCCAGGAGGAGGAATGGGAATTGTTCAGAAATACACATTGATGGATCCAGTCTAAAGGTGCACAGATTCAGTTTTCAAGGGAAACTGAAATAG

GGTGTATTGTTATCTAAACTAATCAGTTCTGAAAGTGCTGATAGGGCGATTTTATCATATTTGGCAGGGAGCAAGAACAGCTTTCATAGGCTCATTTATA

GGACTCAAAATGGAAACTTTTATTTTTATAAAACTGAGATTGAAAATGGCCACTTGTAAAAATTCCTTCCATGGTTGTTACCAAAAGTGTATTTTCCTGT

TTAAAGTGGTTTTGGAAACTTTCAGGCCAACTTATAACTATCATGTTGAATTGTAAATGTGTAGAAATAATGCTTTTTTATTTTGAATTAATAATATTGA

GTACCTACACTGTGCCTAGCCTACCATCAGCATTTCAACATTTCTTTTATTATAAGAGCATCATGTTCTACAGAGTCAATATGATCTCATAAGGTGCAAA

TAAAAACTGCTGGCAGGGCAGGTATAATAATTTCTATCATAGTTTACAAATGGTCTTTGCAAATAGTGATCAGAGGCATTAACGTTTCCCTGAGCTAAGC

TAAATTAAATGCATTCTTTTCTGCCTTGATTATATTACTAATTTTCTTTACCCACATTTGAAATAATCTCAATACTTGCTATTTCAAAACTAAAATGCAA

TGTTATAGGGGGTATACATTGAGTTTTTAATCGTATCAATAATGGTGTGTAAAAACTCAAGAATATTATATAAAGGAGACATTAATTTAAGATTTTCCCA

CCAAATTTAGTATGTTAACCAAAACCTAAAACTTTATATCCATTTAGATGGGAACTTTTTACAAGTACTTTTATGTTGTTTCTGCAAGTCTAGACTTCAA

TAGTAATCATGATATACTAACTATATTTTATTTCTGAATAGTTTTTTAAATTCATGAAAAATTAATAGCCATGAAAACTGATTTTATTGTCATATTTGTT

TAAGCATCTTATTAGTTTACTTCTCTTGCATTAATAGTACTGCTATATTTTGGGTCTGTATATTTATATGTGGCATTTATAAAATTATCTAGTGTTTTAA

AAATACTTTGAAATAAATATTAAAATTAAAATGGTTC
Translation
MGCCFTKRRKSEKAEGEEEQPKLYSWDQREK - UNI34429 - VDPKDYMFSGLKDETVGRLPGKVAGQQFVIQDCENCNIYIFDHSATITIDDCTNC

VIFLGPVKGSVFFRNCRDCKCTLACQQFRVRDCRKLEVFLCCATQPIIESSTNIKFGCFQWYYPELAAQFKDAGLSIFNNIWSHVHDFTPVSGELNWSLL

PENAVVQDYVPIPMTEEFKAVRISTEANRSIVPVSRGQRQKYSDESCLVVLFADDYTTANARKLIDE MVGKGFSLVQTKEMSMKTEDAQRVFQEKASDF

LLLLNKG - UNI34742 - GPVIALEFNGDDAVQECHLIVNGMFNGTK MFVSEKKETASGDVDSFYNFAEIQMGI
Transcript ENSMUST00000115392
Sequence
AGGGTGTTGGGCCTGGCGGGAGTGCTGAGGGTTCCTGGCGGCGGGGCTGCTCCCCTGGGCGGTGTCCGGGGAGCTGTTGGCCGAGTCACCCTGGCTTCCC

GCCACCCTCTGAAAGGTGTCTGAGCGAGTGGGGTCCACTACCAAGACCCTTAGGCCGCACCATGGGCTGCTGCTTCACTAAGAGGAGGAAGAGTGAAAAG

GCTGAGGGAGAGGAGGAGCAGCCCAAGCTGTACAGCTGGGACCAGCGGGAGAAG - UNI34429 - GTTGATCCAAAAGATTACATGTTTAGTGGACT

GAAGGATGAAACAGTAGGTCGCTTACCTGGAAAAGTGGCAGGACAACAATTTGTCATTCAAGACTGTGAGAACTGTAACATCTATATTTTTGACCACTCA

GCTACTATTACCATTGATGACTGCACTAACTGTGTAATTTTTTTGGGACCAGTGAAAGGCAGTGTCTTTTTCCGAAATTGTAGAGATTGCAAGTGCACAT

TGGCTTGCCAGCAATTTCGTGTGAGAGACTGTAGAAAGTTGGAAGTCTTTTTGTGCTGTGCTACTCAACCCATTATTGAATCTTCCACAAACATCAAGTT

TGGCTGTTTTCAATGGTACTACCCTGAATTAGCAGCCCAATTCAAAGATGCAGGCCTCAGTATCTTCAATAACATTTGGAGTCATGTTCATGATTTTACA

CCTGTGTCAGGAGAGCTCAACTGGAGCCTTCTTCCAGAAAATGCCGTGGTTCAAGACTATGTTCCTATCCCAATGACTGAAGAATTCAAAGCTGTGCGAA

TTTCCACAGAAGCCAATAGAAGCATTGTTCCTGTGTCCCGGGGTCAGAGACAGAAGTACAGTGATGAATCATGTCTTGTGGTATTATTTGCCGATGATTA

TACAACTGCAAATGCCAGGAAACTAATTGATGAG ATGGTTGGTAAAGGCTTCTCCCTAGTGCAGACAAAGGAAATGTCAATGAAAACTGAAGACGCCCA

AAGGGTTTTCCAGGAAAAGGCATCAGATTTTTTACTTCTTCTAAACAAAG - UNI34742 - GTCCTGTGATTGCCTTGGAATTTAATGGAGATGACG

CTGTACAAGAATGTCACCTTATTGTAAATGGGATGTTCAACGGGACAAAG - UNI33657 - GTGCTGGGGATGGAACCCAGGACCTTGCTAG GAAA

GAAAACTGAGTGTCAGAAAGTTTGGATGGCCTGTCAAGCTCAAACCATAGTCACTGAACTGCAAT GTCAGAAGAGAGCATTGGATCCCCTGAACTGTGG

TTACAAATGGTTGTAAGCTACCATATGGACATTAGGAACTGGAAGAGCAACAAGTACTCTTAACCACTGAGCCATCTCTCCAG ATCCTCTAGATTTCCT

TTATCCTTCTCCACGTCATCTGTCATCATGGTAGAAGATTCAGTCATGTCCACGTGGGTCAGTGCTTGTCTACTTTCAATACTTTTGAGCAAGGCTGGAA

GACCATGAGTTCAAGGCTACTGTGGGCTATATAATGAGACCCTATCTCCAAATAAACACATGAACAATAAAAGAGTCTAACTCCTTTACTTTC
Translation
MGCCFTKRRKSEKAEGEEEQPKLYSWDQREK - UNI34429 - VDPKDYMFSGLKDETVGRLPGKVAGQQFVIQDCENCNIYIFDHSATITIDDCTNC

VIFLGPVKGSVFFRNCRDCKCTLACQQFRVRDCRKLEVFLCCATQPIIESSTNIKFGCFQWYYPELAAQFKDAGLSIFNNIWSHVHDFTPVSGELNWSLL

PENAVVQDYVPIPMTEEFKAVRISTEANRSIVPVSRGQRQKYSDESCLVVLFADDYTTANARKLIDE MVGKGFSLVQTKEMSMKTEDAQRVFQEKASDF

LLLLNKG - UNI34742 - GPVIALEFNGDDAVQECHLIVNGMFNGTK - UNI33657 - VLGMEPRTLLG GKKTECQKVWMACQAQTIVTELQC

 CQKRALDPLNCGYKWL 

For any suggestions or comments, please send an email to unitrap@crg.es