Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000060188 (Cxcl17)
Chromosomal location
Chr 7: 26185072 - 26197905 (-)
Description
chemokine (C-X-C motif) ligand 17 Gene [Source:MGI Symbol;Acc:MGI:2387642]
UniGene
Mm.10545 
MGI
MGI:2387642 
Uniprot/SPTREMBL
Q8R3U6 
Human Ortholog
ENSG00000189377 (CXCL17)
Omim not available
UniTrap UNI14583
Vector Insertion
Chr 7: 26187875 - 26197906
Public Clones FHCRC-GT-S8-11H1 (fhcrc)
Private Clones not available
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28508
Vector Insertion
Chr 7: 26185464 - 26187166
Public Clones not available
Private Clones OST29360 (lexicon)
Severity of mutation (?) Insertion after 69% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000074040
Sequence
GTAGGATTAAATTGTAGACACTACTCCACCTGAGCAGTTACAAGAAATCAGAAGCCTCTAACTGGTGACAATCCACACAGCCTTTAAGAACCAACAGACA

GCCACAATGAAGCTTCTAGCCTCTCCCTTCCTTCTGTTGCTTCCAGTGATGCTCATGTCCATGGTCTTCAGCAGCCCGAACCCAG - UNI14583 - G

GGTCGCCAGAAGCCACGGGGACCAACACCTGGCTCCTAGGAGGTGGCTCTTGGAAGGTGGCCAAGAATGTGAATGCAAAG - UNI14583 - ATTGGT

TCCTGCAAGCCCCAAAGAGAAAAGCCACAGCAGTGCTGGGGCCACCAAGGAAGCAGTGTCCCTGTGATCACGTCAAGGGCAGGGAGAAAAAAAACAG - 

UNI28508 - GACACCAAAAGCACCACAGGAAGTCGCAAAGACCCTCCAGAGCCTGCCAGCAATTTCTCAAACGATGTCACCTGGCAAGCTTTGCGCTG

CCCTTATAGTACTGAGACTCTGCTCCTCTAGTTAGACTCTCTCAGTGGAAAGGAGGTGACCAGCCCTAGCACGGTTCTTATTCTCCCCACCCCCATCCTC

ACCAAGAGCACCCCAGTGCTCTCTGAAGGCACTGCCTCACAGTGTATCTATGACTGTGCCCCTAGTGCCGGCTGCACTTGCCACTCTTGTCTTATGCCTT

CTGTTTACCCTACAAGAATGCAGGACACCTCGGCCTCCTGTTGGCCTCACATTGCAATCAGAAAACTTGCAATGAAAATAATTAAATACATAGTGCATAC

GTG
Translation
MKLLASPFLLLLPVMLMSMVFSSPNPG - UNI14583 - GVARSHGDQHLAPRRWLLEGGQECECKD - UNI14583 - DWFLQAPKRKATAVLGP

PRKQCPCDHVKGREKKNR - UNI28508 - RTPKAPQEVAKTLQSLPAISQTMSPGKLCAALIVLRLCSSS

For any suggestions or comments, please send an email to unitrap@crg.es