Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000060206 (Zfp462)
Chromosomal location
Chr 4: 54960817 - 55096434 (+)
Description
zinc finger protein 462 Gene [Source:MGI (curated);Acc:Zfp462-001]
RefSeq_dna
NM_172867 
RefSeq_peptide
NP_766455.2 
UniGene
Mm.102904 Mm.415920 
MGI
MGI:107690 
Uniprot/SPTREMBL
B1AWL5 Q4FZD0 Q8CD61 B1AWL4 A2SW42 B1AWL2 B1AWL3 Q69ZA0 
Human Ortholog
ENSG00000148143 (ZNF462)
Omim not available
UniTrap UNI2859
Vector Insertion
Chr 4: 54961105 - 55020404
Public Clones (sanger) AD0173 (sanger) AF0401 (sanger) XG155 (baygenomics) YTC751 (baygenomics)
3SE090C03 (ggtc) 5SD026C11 (ggtc) 3SD178C07 (ggtc) 3SD141G01 (ggtc)
5SP140G10 (ggtc) 5SD039G05 (ggtc) 3SE031F10 (ggtc) 5SD170C04 (ggtc)
5SD123H02 (ggtc) 5SE120E03 (ggtc) 3SE080D03 (ggtc) 3SE003C01 (ggtc)
5SD160F10 (ggtc) 5SE086C03 (ggtc) 5SD021A07 (ggtc) 5SD173F08 (ggtc)
5SD139C08 (ggtc) 5SD049A05 (ggtc) 5SD034B03 (ggtc) 3SE028E10 (ggtc)
3SD170C04 (ggtc) 5SD091H05 (ggtc) 3SE113D07 (ggtc) 5SE068B05 (ggtc)
5SD178C07 (ggtc) 5SP095H04 (ggtc) 5SP144B09 (ggtc) 5SE085C02 (ggtc)
3SD021A07 (ggtc) 3SD173F08 (ggtc) 3SD139C08 (ggtc) 3SD049A05 (ggtc)
3SD034B03 (ggtc) 3SE020D07 (ggtc) 3SD164C08 (ggtc) 3SD091H05 (ggtc)
CMHD-GT_525C5-5S (cmhd) IST14337A10 (tigm) IST14102F10 (tigm) IST12932H7 (tigm)
IST12051G10 (tigm) IST14164F9 (tigm) IST14392B3 (tigm) IST12015E7 (tigm)
IST14456D1 (tigm) IST10714G6 (tigm) IST14520F8 (tigm) IST14141A2 (tigm)
IST10566H9 (tigm) IST10195F9 (tigm) IST11200F3 (tigm) IST11535E8 (tigm)
IST13027E1 (tigm) IST14555C1 (tigm) IST14190E1 (tigm) IST13217A11 (tigm)
IST10545E9 (tigm) IST10439D11 (tigm) IST10876H3 (tigm) IST14637D5 (tigm)
IST14794G1 (tigm) IST10795F3 (tigm) IST14900B8 (tigm) IST14325A3 (tigm)
IST15005D11 (tigm) IST10963B5 (tigm) IST10673D4 (tigm) IST14614G4 (tigm)
IST10198A11 (tigm) IST11534C10 (tigm) IST10418A10 (tigm) IST14452F4 (tigm)
IST15024A2 (tigm) IST14307E7 (tigm) IST14566A3 (tigm) IST11102B7 (tigm)
IST11530C10 (tigm) IST12815B12 (tigm) IST14151B1 (tigm) IST10033C12 (tigm)
IST10461E12 (tigm) IST12819F9 (tigm) IST14676H4 (tigm) IST15054B4 (tigm)
Private Clones OST459052 (lexicon) OST413379 (lexicon) OST168162 (lexicon) OST132439 (lexicon)
OST118694 (lexicon) OST65117 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37681
Vector Insertion
Chr 4: 55020655 - 55024237
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12349
Vector Insertion
Chr 4: 55020655 - 55021127
Public Clones W085B08 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25164
Vector Insertion
Chr 4: 55021127 - 55026722
Public Clones CMHD-GT_375H3-3 (cmhd)
Private Clones OST193314 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI222
Vector Insertion
Chr 4: 55024351 - 55026722
Public Clones GC0660 (tigem) RRR199 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29352
Vector Insertion
Chr 4: 55029973 - 55032960
Public Clones Ayu21-T117 (egtc)
Private Clones not available
Severity of mutation (?) Insertion after 67% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35552
Vector Insertion
Chr 4: 55033080 - 55036286
Public Clones IST10559E7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 69% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17948
Vector Insertion
Chr 4: 55036479 - 55063057
Public Clones IST10550D2 (tigm) IST10110F7 (tigm) IST11411B4 (tigm) IST11084C12 (tigm)
IST11382D4 (tigm) IST13035C9 (tigm) IST11295D10 (tigm)
Private Clones OST432890 (lexicon) OST44568 (lexicon)
Severity of mutation (?) Insertion after 74% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3089
Vector Insertion
Chr 4: 55063326 - 55064062
Public Clones DC0170 (sanger) IST10583F12 (tigm) IST10639H2 (tigm) IST11084C12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 80% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5712
Vector Insertion
Chr 4: 55064200 - 55072885
Public Clones CSI042 (baygenomics) IST11419H1 (tigm) IST10815A12 (tigm)
Private Clones OST364177 (lexicon) OST32050 (lexicon)
Severity of mutation (?) Insertion after 84% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1759
Vector Insertion
Chr 4: 55073110 - 55085844
Public Clones XS0151 (sanger) CF0416 (sanger) RRO515 (baygenomics)
Private Clones OST332381 (lexicon)
Severity of mutation (?) Insertion after 89% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19819
Vector Insertion
Chr 4: 55085978 - 55092135
Public Clones not available
Private Clones OST379587 (lexicon)
Severity of mutation (?) Insertion after 92% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5015
Vector Insertion
Chr 4: 55092260 - 55093537
Public Clones YTC436 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 95% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000079605
Sequence
ATGATGAGAGGGGCTGAAGGGCTCCAAGATTCCCCTCGGCCTCCTGCTCCCTTGCAGCTGAACAGTTCTGAGAGAGATTGCCCTCCTGTGGAGACTGAGA

TGTTTTTTTGCCAGCACTGTGATTATGGGAACCGGACGGTCAAAGGCGTCCTCATTCATTATCAGAAGAAGCACCGGGACTTCAAGGCCAATGCCGATGT

GATCAGGCAGCACACAGCCACCATCCGAAGCCTCTGTGACCGGAACCAGAAGCCTGCCAGCTGTGTGCTTCTCCCTGCTTCCGGTATGGAGCGGGACAAA

ACGAAACTTCGAGCGCTCAAATGTAGGCAGTGCTCGTATACCTCCCCCTATTTCTATGCACTGAGGAAGCATATCAAGAAAGACCACCCTGCCCTGAAGG

CCACAGTCACGTCCATCATGCGGTGGGCATTTCTAGATGGCTTGATAGAAGCTGGCTACCACTGCGAGTGGTGTATCTACTCCCACATGGAGCCCAGTGG

TTTGCTCCTGCATTATCAGAGGAGACACCCTGAGCATTATGTAGATTATACTTATATGGCTACCAAACTCTGGGCTGGGCCAGACCCATCCTCTCCCACT

CTTACCATGTCAGCTGAAGCCAAAACATACAGATGCAGGGACTGCGTTTTTGAAGCCGTCTCCATCTGGGACATCACAAACCATTACCAAGCGTTCCACC

CCTGGGCCATGAATGGTGATGAGTCTGTGTTGCTGGATATCATCAAGGAGAAAGACGGTGTAGACAAGGCCCTCCTGGCACCTGAAGAGTTGATAGGCCC

TGTGAATTGTGAAAATAGTATACCCAACCCCCTTCCCGAGCAGGAAGCTGAGTGCCCAGAGGATGCAAGACTTTCCCCAGAGAAAAGCATTCATCTGGCT

TCAGCTAACCCTGCTATATCTTCCACCCCATACCAGTGTACAGTGTGCCAGTCCGAGTACAACAACTTGCACGGCCTCCTCACCCATTACGGGAAGAAGC

ATCCTGGTATGAAAGTGAAGGCTGCTGATTTTGCCCAGGATATTGACATCAACCCAGGTGCCGTCTACAAATGCAGGCATTGTCCGTACATCAACACTCG

CATCCATGGCGTCCTGACCCACTATCAGAAGCGACACCCGGCCATCAAGGTGACCGCTGAGGACTTTGTGCATGATGTGGAGCAGTCTGCTGACATATCC

CAGAATGACGTGGAGGAGACAAGTAGGATTTTTAAACAAGGGTATGGTGCCTACCGGTGCAAGCTGTGTCCTTACACACACGGCACTCTGGAGAAACTCA

AAATCCACTATGAGAAGTACCACAACCAGCCTGAGTTTGATGTCTTTTCCCCGCCTCCTCCGAAGCTGCCAGTGTCCCTTGAACCTGAGATAACCACTGA

AGTGAGCCCCTCCCAGGTCTCCGTGACGGAGGAGGAGGTGGGAGAGGATCCTATGTCCACTGCTCACTTCTCTACCTCGCATCTGGTCTCCCACACTGTG

TTCCGGTGCCAGCTCTGCAAGTACTTCTGTTCCACTAGGAAGGGCATTGCCAGGCACTACCGGATCAAGCACAATAATGTCCGTGCCCAGCCCGAGGGCA

AAAACAATCTCTTCAAGTGTGCCCTGTGTGCCTACACCAACCCCATCCGCAAGGGACTGGCAGCCCACTACCAGAAGCGCCACGACATTGATGCATATTA

CACCCACTGCCTTGCGGCCTCCAGGACCATCAGTGACAAGCCCAACAAGGTGATCATCCCATCCCCACCCAAAGATGACTCTCCTCAGCTGAGCGAGGAA

CTCCGGCGGGCTGTGGAGAAGAAAAAGTGCTCCTTATGTTCCTTCCAGTCCTTCAGCAAGAAAGGCATTGTGTCCCATTATATGAAGCGCCACCCGGGGG

TGTTCCCAAAGAAGCAGCATGCCAGCAAGTTGGGGGGCTACTTCACAGCGGTCTACGCAGATGAACACGAGAAACCCCCACTGATGGAAGAAGAGGAGAG

AAGCAGCTTTGAGAGGGCCGAGGTGGAAGGCGAAGCTCAAGACATCGAGTGGCTCCCGTTCCGCTGCATCAAATGCTTCAAGCTGTCCTTCAGCACGGCG

GAGTTGCTGTGCATGCATTACACAGACCACCACAGCAGGGACTTAAAGAGGGACTTCGTCATCCTAGGCAGCGGCCCCCGCTTCCAGAACTCCACCTTCC

AGTGTAAGCACTGTGATAGCAAATTGCAAAGCATAGCCGAGCTGACCTCACACTTGAACATCCACAATGAGGAATTCCAGAAGCGTGCCAAACGCCAGGA

GAGGAGGAAACAGCTTTTGAGCAAGCAGAAATATGCAGATGGTGCTTTTGCAGATTTCAAACAAGAGAGG - UNI222 - - UNI25164 - CCTTT

TGGTCACTTAGAAGAGGTGCCAAAGATCAAGGAGAGGAAAGTGGTGGGCTACAAGTGTAAATTCTGCGTGGAAGTGCATCCAACGCTTCGGGCCATCTGT

AACCACCTCCGGAAACATGTCCAGTATGGTAGCGTCCCGGCTGTGTCGGCTGCTGTGAAG CAGGAGGCTGAAGACCCTTCCCACCTGTTCCTGGATGGA

TTGGAAGCAGCCAGAGACGCCAGTGGCACACTGGTGGGCCGGGTGGATGGTGGACACTGCTTGCTTGATGCAATGTTGGAGGATGAAACCCGGCCGGGGG

GATACCATTGCAGTCAATGTGACCGGGTCCTGATGTCCATGCAGGGGCTGCGTTCTCATGAGAGGAGCCACCTGGCCTTGGCCATGTTTACCAGAGAGGA

CAAGTACAGCTGCCAGTATTGCTCCTTTGTTTCTGCATTCAGACACAA - UNI29352 - CTTGGATCGCCATATGCAGACCCATCACGGACACCACA

AACCGTTCCGCTGCAAACTCTGCTCTTTCAAGTCCTCCTACAACAGCCGGTTGAAGACACACATCCTCAAAGCCCATGCTG - UNI35552 - GTGAA

CATGCCTACAAGTGTTCTTGGTGCTCATTTTCCACCATGACAATCAGCCAGTTGAAGGAACATTCCCTCAAGGTCCATGGCAAAGCCCTGACCCTTCCCC

GGCCACGGATTGTCAGTCTCCTCTCCTCACATGCTCACCCCTCCTCCCAGAAGGCCACTCCAGCCGAAGAAGTGGAAGACTCCAATG - UNI17948 -

 ACTCCTCTTACTCGGAGCCCCCCGATGTTCAGCAGCAGCTGAATCACTACCAGTCAGCCGCCCTGGCAAGAAACAAGAGCCGCGTTAGCCCTGTGCCTC

CTTCTGGGACTGCTGCTGGCACGGAACAGAAGGCAGAAGCCGTTCTTCACTGCGAATTCTGTGAATTCTCCTCTGGCTACATCCAGAGCATCAGGCGCCA

TTACCGGGACAAGCACGGTGGGAAGAAGCTTTTCAAATGCAAAGACTGCTCCTTTTACACCGGCTTTAA - UNI3089 - ATCTGCTTTTACTATGCA

CGTGGAAGCTGGGCATTCGGCGGTCCCGGAGGAAGGCCCCAAAGATCTCCGCTGTCCTCTCTGCCTCTATCACACCAAATACAAACGCAACATGATCGAC

CACATAGTGCTGCACCGAG - UNI5712 - AAGAGCGAGTTGTCCCCATTGAAGTGTGCCGTTCCAAACTGTCAAAATACTTGCAGGGAGTAGTTTTC

CGCTGTGATAAGTGTACCTTCACCTGCTCCAGTGACGAGAGTCTCCAGCAACACATAGAAAAGCACAATGAACTGAAACCGTACAAATGCCAGCTCTGCT

ACTATGAGACCAAGCACACGGAGGAACTGGACACTCACCTTCGGGATGAGCACAAG - UNI1759 - GTGAGCCGGAACTTTGAGCTGGTTGGCCGGG

TGAACTTGGATCAGCTGGAACAGATGAAGGAGAAGATTGAGAGTTCCAGCAGCGAGGACGAGGACAAGGACGACGAAATGAGCAGCAAGGCTGAGGACAG

AG - UNI19819 - AGCTGATGAGATTTGCAGACCGGGGGCCTGGTGTGAACACAGAGAAGCGATTTCCATGTGAATTCTGTGGACGGGCGTTCTCAC

AGGGCTCTGAGTGGGAAAGACACGTGTTGAGACACGGCAT - UNI5015 - GTCATTGCATGATACCAACCAAGTGAGCAGGAACGAAATCCATACAA

AGGAGATGGTGGAGGAGAGTATGCAGCTGCCCTCCATAGAGGCCAAGGAAGACGATGAGCCAATTGGGATAGACTTTCCCTTAAAGAGCGAAACAGTAAC

CATCTGTGTAGTGGCTGCCGACAAATCTCTCCTGGAGGATGCAGAGGCCAAAAACGAATAAGAGTTTGGTGAAATTCTTATCAAACCTTACTTGAACCGT

GATGAAAATGTGGGCGGGCCGGCGTGGGCTGAGAAGGGAGGGGACAGACAGAGGAGAGAAGAAGACAGAACAAAGCTGCTTTTAGGACTGAACAATCTAT

TTTCAAAGCACTGGTACCTGTGTGAGTGAGTATGTAAATTAAAGTTATTTAAATGGTTGGAATATGTGGCTCCTTTCCTGTCACGACATCCTTCCTTCCG

GATCTTCACCACGGAGATTTTCATCTGCTGCGGTTTGGGAAGTACCTCCCGTGGGCACGGTGGTCTCCGTGACCCTCTCGGACAGTGTGTGGAAACCGAG

GCTCCCGGACACAGAAGACTTCTCCTAGGGGAACAACTTTTGGGCGCACAACTTTCTGTGCGTTTTTCTAGTTTTAATACCTTAAGCTTTTTCAAGACCT

AACTGCAGCCGCTTTGGG
Translation
MMRGAEGLQDSPRPPAPLQLNSSERDCPPVETEMFFCQHCDYGNRTVKGVLIHYQKKHRDFKANADVIRQHTATIRSLCDRNQKPASCVLLPASGMERDK

TKLRALKCRQCSYTSPYFYALRKHIKKDHPALKATVTSIMRWAFLDGLIEAGYHCEWCIYSHMEPSGLLLHYQRRHPEHYVDYTYMATKLWAGPDPSSPT

LTMSAEAKTYRCRDCVFEAVSIWDITNHYQAFHPWAMNGDESVLLDIIKEKDGVDKALLAPEELIGPVNCENSIPNPLPEQEAECPEDARLSPEKSIHLA

SANPAISSTPYQCTVCQSEYNNLHGLLTHYGKKHPGMKVKAADFAQDIDINPGAVYKCRHCPYINTRIHGVLTHYQKRHPAIKVTAEDFVHDVEQSADIS

QNDVEETSRIFKQGYGAYRCKLCPYTHGTLEKLKIHYEKYHNQPEFDVFSPPPPKLPVSLEPEITTEVSPSQVSVTEEEVGEDPMSTAHFSTSHLVSHTV

FRCQLCKYFCSTRKGIARHYRIKHNNVRAQPEGKNNLFKCALCAYTNPIRKGLAAHYQKRHDIDAYYTHCLAASRTISDKPNKVIIPSPPKDDSPQLSEE

LRRAVEKKKCSLCSFQSFSKKGIVSHYMKRHPGVFPKKQHASKLGGYFTAVYADEHEKPPLMEEEERSSFERAEVEGEAQDIEWLPFRCIKCFKLSFSTA

ELLCMHYTDHHSRDLKRDFVILGSGPRFQNSTFQCKHCDSKLQSIAELTSHLNIHNEEFQKRAKRQERRKQLLSKQKYADGAFADFKQER - UNI222 

- - UNI25164 - PFGHLEEVPKIKERKVVGYKCKFCVEVHPTLRAICNHLRKHVQYGSVPAVSAAVK QEAEDPSHLFLDGLEAARDASGTLVGRVD

GGHCLLDAMLEDETRPGGYHCSQCDRVLMSMQGLRSHERSHLALAMFTREDKYSCQYCSFVSAFRHN - UNI29352 - NLDRHMQTHHGHHKPFRCK

LCSFKSSYNSRLKTHILKAHAG - UNI35552 - GEHAYKCSWCSFSTMTISQLKEHSLKVHGKALTLPRPRIVSLLSSHAHPSSQKATPAEEVEDSN

D - UNI17948 - DSSYSEPPDVQQQLNHYQSAALARNKSRVSPVPPSGTAAGTEQKAEAVLHCEFCEFSSGYIQSIRRHYRDKHGGKKLFKCKDCSF

YTGFK - UNI3089 - KSAFTMHVEAGHSAVPEEGPKDLRCPLCLYHTKYKRNMIDHIVLHRE - UNI5712 - EERVVPIEVCRSKLSKYLQGVV

FRCDKCTFTCSSDESLQQHIEKHNELKPYKCQLCYYETKHTEELDTHLRDEHK - UNI1759 - VSRNFELVGRVNLDQLEQMKEKIESSSSEDEDKD

DEMSSKAEDRE - UNI19819 - ELMRFADRGPGVNTEKRFPCEFCGRAFSQGSEWERHVLRHGM - UNI5015 - MSLHDTNQVSRNEIHTKEMV

EESMQLPSIEAKEDDEPIGIDFPLKSETVTICVVAADKSLLEDAEAKNE
Transcript ENSMUST00000030131
Sequence
CACTGCTCCTACAGCAATCGGTCAGTTGTGGGGGTGCTTGTTCACTACCAGAAAAGACACCCAGAAATAAAGGTCACTGCCAAATATATCAGACAGGCTC

CTCCCACAGCTGCAATGATGAGAGGGGCTGAAGGGCTCCAAGATTCCCCTCGGCCTCCTGCTCCCTTGCAGCTGAACAGTTCTGAGAGAGATTGCCCTCC

TGTGGAGACTGAGATGTTTTTTTGCCAGCACTGTGATTATGGGAACCGGACGGTCAAAGGCGTCCTCATTCATTATCAGAAGAAGCACCGGGACTTCAAG

GCCAATGCCGATGTGATCAGGCAGCACACAGCCACCATCCGAAGCCTCTGTGACCGGAACCAGAAGCCTGCCAGCTGTGTGCTTCTCCCTGCTTCCGGTA

TGGAGCGGGACAAAACGAAACTTCGAGCGCTCAAATGTAGGCAGTGCTCGTATACCTCCCCCTATTTCTATGCACTGAGGAAGCATATCAAGAAAGACCA

CCCTGCCCTGAAGGCCACAGTCACGTCCATCATGCGGTGGGCATTTCTAGATGGCTTGATAGAAGCTGGCTACCACTGCGAGTGGTGTATCTACTCCCAC

ATGGAGCCCAGTGGTTTGCTCCTGCATTATCAGAGGAGACACCCTGAGCATTATGTAGATTATACTTATATGGCTACCAAACTCTGGGCTGGGCCAGACC

CATCCTCTCCCACTCTTACCATGTCAGCTGAAGCCAAAACATACAGATGCAGGGACTGCGTTTTTGAAGCCGTCTCCATCTGGGACATCACAAACCATTA

CCAAGCGTTCCACCCCTGGGCCATGAATGGTGATGAGTCTGTGTTGCTGGATATCATCAAGGAGAAAGACGGTGTAGACAAGGCCCTCCTGGCACCTGAA

GAGTTGATAGGCCCTGTGAATTGTGAAAATAGTATACCCAACCCCCTTCCCGAGCAGGAAGCTGAGTGCCCAGAGGATGCAAGACTTTCCCCAGAGAAAA

GCATTCATCTGGCTTCAGCTAACCCTGCTATATCTTCCACCCCATACCAGTGTACAGTGTGCCAGTCCGAGTACAACAACTTGCACGGCCTCCTCACCCA

TTACGGGAAGAAGCATCCTGGTATGAAAGTGAAGGCTGCTGATTTTGCCCAGGATATTGACATCAACCCAGGTGCCGTCTACAAATGCAGGCATTGTCCG

TACATCAACACTCGCATCCATGGCGTCCTGACCCACTATCAGAAGCGACACCCGGCCATCAAGGTGACCGCTGAGGACTTTGTGCATGATGTGGAGCAGT

CTGCTGACATATCCCAGAATGACGTGGAGGAGACAAGTAGGATTTTTAAACAAGGGTATGGTGCCTACCGGTGCAAGCTGTGTCCTTACACACACGGCAC

TCTGGAGAAACTCAAAATCCACTATGAGAAGTACCACAACCAGCCTGAGTTTGATGTCTTTTCCCCGCCTCCTCCGAAGCTGCCAGTGTCCCTTGAACCT

GAGATAACCACTGAAGTGAGCCCCTCCCAGGTCTCCGTGACGGAGGAGGAGGTGGGAGAGGATCCTATGTCCACTGCTCACTTCTCTACCTCGCATCTGG

TCTCCCACACTGTGTTCCGGTGCCAGCTCTGCAAGTACTTCTGTTCCACTAGGAAGGGCATTGCCAGGCACTACCGGATCAAGCACAATAATGTCCGTGC

CCAGCCCGAGGGCAAAAACAATCTCTTCAAGTGTGCCCTGTGTGCCTACACCAACCCCATCCGCAAGGGACTGGCAGCCCACTACCAGAAGCGCCACGAC

ATTGATGCATATTACACCCACTGCCTTGCGGCCTCCAGGACCATCAGTGACAAGCCCAACAAGGTGATCATCCCATCCCCACCCAAAGATGACTCTCCTC

AGCTGAGCGAGGAACTCCGGCGGGCTGTGGAGAAGAAAAAGTGCTCCTTATGTTCCTTCCAGTCCTTCAGCAAGAAAGGCATTGTGTCCCATTATATGAA

GCGCCACCCGGGGGTGTTCCCAAAGAAGCAGCATGCCAGCAAGTTGGGGGGCTACTTCACAGCGGTCTACGCAGATGAACACGAGAAACCCCCACTGATG

GAAGAAGAGGAGAGAAGCAGCTTTGAGAGGGCCGAGGTGGAAGGCGAAGCTCAAGACATCGAGTGGCTCCCGTTCCGCTGCATCAAATGCTTCAAGCTGT

CCTTCAGCACGGCGGAGTTGCTGTGCATGCATTACACAGACCACCACAGCAGGGACTTAAAGAGGGACTTCGTCATCCTAGGCAGCGGCCCCCGCTTCCA

GAACTCCACCTTCCAGTGTAAGCACTGTGATAGCAAATTGCAAAGCATAGCCGAGCTGACCTCACACTTGAACATCCACAATGAGGAATTCCAGAAGCGT

GCCAAACGCCAGGAGAGGAGGAAACAGCTTTTGAGCAAGCAGAAATATGCAGATGGTGCTTTTGCAGATTTCAAACAAGAGAGG - UNI222 - - UN

I25164 - CCTTTTGGTCACTTAGAAGAGGTGCCAAAGATCAAGGAGAGGAAAGTGGTGGGCTACAAGTGTAAATTCTGCGTGGAAGTGCATCCAACGC

TTCGGGCCATCTGTAACCACCTCCGGAAACATGTCCAGTATGGTAGCGTCCCGGCTGTGTCGGCTGCTGTGAAG GAGGCTGAAGACCCTTCCCACCTGT

TCCTGGATGGATTGGAAGCAGCCAGAGACGCCAGTGGCACACTGGTGGGCCGGGTGGATGGTGGACACTGCTTGCTTGATGCAATGTTGGAGGATGAAAC

CCGGCCGGGGGGATACCATTGCAGTCAATGTGACCGGGTCCTGATGTCCATGCAGGGGCTGCGTTCTCATGAGAGGAGCCACCTGGCCTTGGCCATGTTT

ACCAGAGAGGACAAGTACAGCTGCCAGTATTGCTCCTTTGTTTCTGCATTCAGACACAA - UNI29352 - CTTGGATCGCCATATGCAGACCCATCA

CGGACACCACAAACCGTTCCGCTGCAAACTCTGCTCTTTCAAGTCCTCCTACAACAGCCGGTTGAAGACACACATCCTCAAAGCCCATGCTG - UNI35

552 - GTGAACATGCCTACAAGTGTTCTTGGTGCTCATTTTCCACCATGACAATCAGCCAGTTGAAGGAACATTCCCTCAAGGTCCATGGCAAAGCCCT

GACCCTTCCCCGGCCACGGATTGTCAGTCTCCTCTCCTCACATGCTCACCCCTCCTCCCAGAAGGCCACTCCAGCCGAAGAAGTGGAAGACTCCAATG -

 UNI17948 - ACTCCTCTTACTCGGAGCCCCCCGATGTTCAGCAGCAGCTGAATCACTACCAGTCAGCCGCCCTGGCAAGAAACAAGAGCCGCGTTAG

CCCTGTGCCTCCTTCTGGGACTGCTGCTGGCACGGAACAGAAGGCAGAAGCCGTTCTTCACTGCGAATTCTGTGAATTCTCCTCTGGCTACATCCAGAGC

ATCAGGCGCCATTACCGGGACAAGCACGGTGGGAAGAAGCTTTTCAAATGCAAAGACTGCTCCTTTTACACCGGCTTTAA - UNI3089 - ATCTGCT

TTTACTATGCACGTGGAAGCTGGGCATTCGGCGGTCCCGGAGGAAGGCCCCAAAGATCTCCGCTGTCCTCTCTGCCTCTATCACACCAAATACAAACGCA

ACATGATCGACCACATAGTGCTGCACCGAG - UNI5712 - AAGAGCGAGTTGTCCCCATTGAAGTGTGCCGTTCCAAACTGTCAAAATACTTGCAGG

GAGTAGTTTTCCGCTGTGATAAGTGTACCTTCACCTGCTCCAGTGACGAGAGTCTCCAGCAACACATAGAAAAGCACAATGAACTGAAACCGTACAAATG

CCAGCTCTGCTACTATGAGACCAAGCACACGGAGGAACTGGACACTCACCTTCGGGATGAGCACAAG - UNI1759 - GTGAGCCGGAACTTTGAGCT

GGTTGGCCGGGTGAACTTGGATCAGCTGGAACAGATGAAGGAGAAGATTGAGAGTTCCAGCAGCGAGGACGAGGACAAGGACGACGAAATGAGCAGCAAG

GCTGAGGACAGAG - UNI19819 - AGCTGATGAGATTTGCAGACCGGGGGCCTGGTGTGAACACAGAGAAGCGATTTCCATGTGAATTCTGTGGACG

GGCGTTCTCACAGGGCTCTGAGTGGGAAAGACACGTGTTGAGACACGGCAT - UNI5015 - GTCATTGCATGATACCAACCAAGTGAGCAGGAACGA

AATCCATACAAAGGAGATGGTGGAGGAGAGTATGCAGCTGCCCTCCATAGAGGCCAAGGAAGACGATGAGCCAATTGGGATAGACTTTCCCTTAAAGAGC

GAAACAGTAACCATCTGTGTAGTGGCTGCCGACAAATCTCTCCTGGAGGATGCAGAGGCCAAAAACGAATAAGAGTTTGGTGAAATTCTTATCAAACCTT

ACTTGAACCGTGATGAAAATGTGGGCGGGCCGGCGTGGGCTGAGAAGGGAGGGGACAGACAGAGGAGAGAAGAAGACAGAACAAAGCTGCTTTTAGGACT

GAACAATCTATTTTCAAAGCACTGGTACCTGTGTGAGTGAGTATGTAAATTAAAGTTATTTAAATGGTTGGAATATGTGGCTCCTTTCCTGTCACGACAT

CCTTCCTTCCGGATCTTCACCACGGAGATTTTCATCTGCTGCGGTTTGGGAAGTACCTCCCGTGGGCACGGTGGTCTCCGTGACCCTCTCGGACAGTGTG

TGGAAACCGAGGCTCCCGGACACAGAAGACTTCTCCTAGGGGAACAACTTTTGGGCGCACAACTTTCTGTGCGTTTTTCTAGTTTTAATACCTTAAGCTT

TTTCAAGACCTAACTGCAGCCGCTTTGGGAGAAAAAAAAATAACAAAACAGAAAACA
Translation
MMRGAEGLQDSPRPPAPLQLNSSERDCPPVETEMFFCQHCDYGNRTVKGVLIHYQKKHRDFKANADVIRQHTATIRSLCDRNQKPASCVLLPASGMERDK

TKLRALKCRQCSYTSPYFYALRKHIKKDHPALKATVTSIMRWAFLDGLIEAGYHCEWCIYSHMEPSGLLLHYQRRHPEHYVDYTYMATKLWAGPDPSSPT

LTMSAEAKTYRCRDCVFEAVSIWDITNHYQAFHPWAMNGDESVLLDIIKEKDGVDKALLAPEELIGPVNCENSIPNPLPEQEAECPEDARLSPEKSIHLA

SANPAISSTPYQCTVCQSEYNNLHGLLTHYGKKHPGMKVKAADFAQDIDINPGAVYKCRHCPYINTRIHGVLTHYQKRHPAIKVTAEDFVHDVEQSADIS

QNDVEETSRIFKQGYGAYRCKLCPYTHGTLEKLKIHYEKYHNQPEFDVFSPPPPKLPVSLEPEITTEVSPSQVSVTEEEVGEDPMSTAHFSTSHLVSHTV

FRCQLCKYFCSTRKGIARHYRIKHNNVRAQPEGKNNLFKCALCAYTNPIRKGLAAHYQKRHDIDAYYTHCLAASRTISDKPNKVIIPSPPKDDSPQLSEE

LRRAVEKKKCSLCSFQSFSKKGIVSHYMKRHPGVFPKKQHASKLGGYFTAVYADEHEKPPLMEEEERSSFERAEVEGEAQDIEWLPFRCIKCFKLSFSTA

ELLCMHYTDHHSRDLKRDFVILGSGPRFQNSTFQCKHCDSKLQSIAELTSHLNIHNEEFQKRAKRQERRKQLLSKQKYADGAFADFKQER - UNI222 

- - UNI25164 - PFGHLEEVPKIKERKVVGYKCKFCVEVHPTLRAICNHLRKHVQYGSVPAVSAAVK EAEDPSHLFLDGLEAARDASGTLVGRVDG

GHCLLDAMLEDETRPGGYHCSQCDRVLMSMQGLRSHERSHLALAMFTREDKYSCQYCSFVSAFRHN - UNI29352 - NLDRHMQTHHGHHKPFRCKL

CSFKSSYNSRLKTHILKAHAG - UNI35552 - GEHAYKCSWCSFSTMTISQLKEHSLKVHGKALTLPRPRIVSLLSSHAHPSSQKATPAEEVEDSND

 - UNI17948 - DSSYSEPPDVQQQLNHYQSAALARNKSRVSPVPPSGTAAGTEQKAEAVLHCEFCEFSSGYIQSIRRHYRDKHGGKKLFKCKDCSFY

TGFK - UNI3089 - KSAFTMHVEAGHSAVPEEGPKDLRCPLCLYHTKYKRNMIDHIVLHRE - UNI5712 - EERVVPIEVCRSKLSKYLQGVVF

RCDKCTFTCSSDESLQQHIEKHNELKPYKCQLCYYETKHTEELDTHLRDEHK - UNI1759 - VSRNFELVGRVNLDQLEQMKEKIESSSSEDEDKDD

EMSSKAEDRE - UNI19819 - ELMRFADRGPGVNTEKRFPCEFCGRAFSQGSEWERHVLRHGM - UNI5015 - MSLHDTNQVSRNEIHTKEMVE

ESMQLPSIEAKEDDEPIGIDFPLKSETVTICVVAADKSLLEDAEAKNE
Transcript ENSMUST00000098070
Sequence
AGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAGAAGAGGGGAGGGAGGGAGAGGGGAGAGAGACGGATATCTCAGGTCATCTGCAGCTGCAGCGA

GTCTGAGGAGCCGAGGAAGGCAGGGAAGATGGCGATCCTCCATTGCTGAGACCCGGCAGAAGCACATGAGACTCCCAAACAACTTCCACAACAATAACCC

GAGCAGGAAGAGGAGAAAGAGAAAGAGGATAAGGAGGCGGTGGGGCTGGAGAACCCGAAGCACCTCCCGGCGCCGGGACGCTTCTTCT - UNI2859 -

 GTTCCTGATGTGAGAGGGTAGCCCCCGATCATGGAGGTGCTTCAGTGCGATGGCTGTGACTTCCGAGCCCCATCTTACGAAGATCTCAAGGCACACATC

CAGGATGTCCACACGGCATTCTTACAGCCAACTGATGTTGCCGAGGACAATGATGACGAGCCACTATCTGGGTCCATGAATGCTAGTAATCAGACAGAGG

TGGAGTTCTCTTCTATAAAGGATGAGTTTGTGATTGCAGAGGATTTACCAG - UNI12349 - - UNI25164 - GTCAAAGTGCAACTGCGTTGGG

GAGCGGAGGTTACTATGGCCACAGTCCAGGATATTACGGTCAGCATATTACCCCTAATCCCAAACCAACCAACAAATTTTTTCAGTGCAAGTTCTGCGTA

CGCTACTTCAGGTCAAAAAATCTCCTCATAGAACATACTAGGAAGGTCCATGGAGCTCAAGCTGAAGAGAGTCCCACAGGACCTCCTGTCCCAGGATCCT

TAAATTATAATATCATGATGCACGAAGGATTTGGAAAGGTCTTTTCTTGCCAGTTTTGCACATACAAATCACCTCGGAGGGCAAGGATAATTAAGCATCA

GAAGATGTACCACAAAAACAGTCTGAAGGAGTCCACAGCGCCACCACCTGCCCCTGCTCCACTGCCAGACCCTCTGGTTCCACCTGTGTCACTGCAGGAC

CCCTGCAAGGAACTGCCGGCAGAGGTTGTTGAGCGCAGCATCTTAGAATCTATGGTCAAGCCTTTGACCAAGTCTCGGGGCAACTTTTGTTGTGAGTGGT

GTAGCTACCAGACCCCCCGCAGAGAACGCTGGTGCGATCACATGATGAAGAAACACCGCAGTATGGTCAAGATCCTTTCTAGCATCCGGCAGCAAGAAGG

GCCTAATGTCTCTGAAGCGCAGAATGATAATGAACCCAGCCCCACCTCCAACTCCACCTACCTGTCCATGAATGCTGCGAGCCGGGAGATGCCCAACGCT

AACGTCTCCAATTTCAGGGGCTCCATGGGCAACTCCATCATGAGACCTAATTCTTCTTCAACTTCCAAGTTTTCTTCTTCTATGTCTTACCCTCAGATGA

AGCCGAAGTCACCTCATAATTCTGGCCTTGTGAACTTGACGGAGAGGTCCCGTTACGGAATGTCTGACATGACGAATTCATCTGCTGACCTGGACACTAA

CAGCATGCTAAATGACTCTAGCTCTGATGAGGACTTAAATGAGGTAGACAGTGAGAATGGTTTAAGTGTTCTGGATCACCAGGCGTCAGGACTGTCTGCA

GAGCAGCTCATGGGCTCTGATGGCAACAAGCTGTTAGAGACCAAGGGGATTCCATTTCGAAGGTTCATGAATAGATTCCAGTGTCCCTTTTGTCCTTTCC

TCACCATGCACCGCCGTAGCATTTCCCGCCACATAGAAAATATCCACTTATCTGGAAAGACCGCTGTCTACAAATGTGACGAGTGTCCGTTTACTTGTAA

GAGCTCATTAAAACTCGGGGCTCATAAACAGTGTCACACGGGTACGTCGGATTGGGATACTGTGAATTCTCAAAGCGAAAGCCTGTCTTCCTCGTTGAAT

GAAGGAATGGTATCTTACGAGAGCTCCAGCATCAATGGTAGAAAGTCGGGAGTCATGTTGGACCCCTTACAGCAGCAGCAGCCACCACAGCCACCTCCGC

CACTACCACCACCACCACCACCACCATCACAGCCACTGCCGCAGCCTCCACCTCCACCGCTGCAGTCACCACACCAGGTGCCACCACCAACCCAGCAGCC

ACAGCCACCCACACAGGCCCCACCTTTGCACCCTTACAAGTGCACCATGTGTAGTTATTCCACCATGACTCTGAAAGGGCTAAGAGTCCATCAGCAGCAC

AAACATTCATTCTGCGACAACTTGCCAAAATTCGAGGGGCAGCCCTCGAGCCTACCACTGGAAAATGAGACGGATAGCCACCCCTCTTCCAGCAACACTG

TGAAGAAAAGTCAGACCTCAATTCTTGGATTGTCCTCCAAGAATAACTTTGTAGCTAAGGCCAATAGGAAGCTTGCTAGTGACTTTCCTCTTGACTTATC

ACCTGTGAAGAAGAGAACAAGGATTGACGAGATAGCCAGCAATTTGCAGAGCAAAATCAACCAGACCAAACTGCAGGAAGACGCGATCATCAACGTCGAG

GACGATGAGGAGGAAGAGGATGACAACGAAGTCGAGATCGAGGTTGAACTGGACAGGGAGGAGGAGGCAACGGACCCCATCATGGAGGTGCCCACTGCCT

TTTCAGCCCAACAGATCTGGGCCAGAGACGCTAGTGAGGCCCAGAAGGAGCCCAACTACAGAAGTATCACTCATGATTACACTGCCACCAATGGGGCGGA

GATCGAGCTCACGCTTTCTGAAGACGAAGAGGATTACTACGGCTCTTCAGCAAGCATGAAAGATCAAGTGTCCAATGCGGCTCTGCTGAACACCCAGCCC

GCTATCTATGGGACGGAACCCAGTAATGAAAATACCGATTTTGGGGACTCTGGAAGGCTTTACTATTGTAAACACTGTGACTTTAATAATAAATCTGCCC

GGAGTGTTAGCACCCACTACCAGCGAATGCACCCATACATTAAGTTCAGCTTTAGGTATATCTTGGACCCCAATGATCACAGCGCAGTGTACAGGTGCCT

GGAATGCTATATTGACTACACCAACTTTGAAGACCTCCAACAGCATTATGGTGAACACCACCCAGAGGCCATGAATGTACTCAACTTTGACCATTCGGAC

CTGATCTACCGATGTCGGTTTTGTTCTTACACTAGCCCGAATGTCAGAAGCCTGATGCCGCATTACCAAAGAATGCATCCCACGGTGAAAATCAACAATG

CTATGATCTTTTCAAGCTACGTTGTAGAGCAGCAGGAAGGGCTGAATGCTGAGTCCCAGACCCTGCGGGAGATTTTGAATTCAGCTCCCAAGAGCATGGC

GACGTCCACGCCTGTGGCTCGCGGTGGTGGCTTGCCAGCTACGTTTAACAAAAACACTCCTCCCAAGACCTTTACTCCAGAATGTGAAAGCCAGAAGGAC

CCTTCAGTGAACACCGTTGTCGTTTACGATTGTGACGTTTGCTCGTTTGCGAGCCCCAACATGCACTCTGTCTTGGTTCACTATCAGAAGAAACACCCTG

AAGAAAAGGCCTCGTACTTTAGGATCCAGAAAACCATGCGCATGGTGTCTGTGGACAGAGGCTCTGCCCTTTCCCAATTATCATTTGAGGTGGGTGCTCC

AATGTCTCCCAAAATGTCCAACATGGGTTCCCCACCCCCCCCACAGCCCCCGCCACCAGACCTCAGTATTGAGCTTTACTACTGCAAACACTGCTCCTAC

AGCAATCGGTCAGTTGTGGGGGTGCTTGTTCACTACCAGAAAAGACACCCAGAAATAAAGGTCACTGCCAAATATATCAGACAGGCTCCTCCCACAGCTG

CAATGATGAGAGGGGCTGAAGGGCTCCAAGATTCCCCTCGGCCTCCTGCTCCCTTGCAGCTGAACAGTTCTGAGAGAGATTGCCCTCCTGTGGAGACTGA

GATGTTTTTTTGCCAGCACTGTGATTATGGGAACCGGACGGTCAAAGGCGTCCTCATTCATTATCAGAAGAAGCACCGGGACTTCAAGGCCAATGCCGAT

GTGATCAGGCAGCACACAGCCACCATCCGAAGCCTCTGTGACCGGAACCAGAAGCCTGCCAGCTGTGTGCTTCTCCCTGCTTCCGGTATGGAGCGGGACA

AAACGAAACTTCGAGCGCTCAAATGTAGGCAGTGCTCGTATACCTCCCCCTATTTCTATGCACTGAGGAAGCATATCAAGAAAGACCACCCTGCCCTGAA

GGCCACAGTCACGTCCATCATGCGGTGGGCATTTCTAGATGGCTTGATAGAAGCTGGCTACCACTGCGAGTGGTGTATCTACTCCCACATGGAGCCCAGT

GGTTTGCTCCTGCATTATCAGAGGAGACACCCTGAGCATTATGTAGATTATACTTATATGGCTACCAAACTCTGGGCTGGGCCAGACCCATCCTCTCCCA

CTCTTACCATGTCAGCTGAAGCCAAAACATACAGATGCAGGGACTGCGTTTTTGAAGCCGTCTCCATCTGGGACATCACAAACCATTACCAAGCGTTCCA

CCCCTGGGCCATGAATGGTGATGAGTCTGTGTTGCTGGATATCATCAAGGAGAAAGACGGTGTAGACAAGGCCCTCCTGGCACCTGAAGAGTTGATAGGC

CCTGTGAATTGTGAAAATAGTATACCCAACCCCCTTCCCGAGCAGGAAGCTGAGTGCCCAGAGGATGCAAGACTTTCCCCAGAGAAAAGCATTCATCTGG

CTTCAGCTAACCCTGCTATATCTTCCACCCCATACCAGTGTACAGTGTGCCAGTCCGAGTACAACAACTTGCACGGCCTCCTCACCCATTACGGGAAGAA

GCATCCTGGTATGAAAGTGAAGGCTGCTGATTTTGCCCAGGATATTGACATCAACCCAGGTGCCGTCTACAAATGCAGGCATTGTCCGTACATCAACACT

CGCATCCATGGCGTCCTGACCCACTATCAGAAGCGACACCCGGCCATCAAGGTGACCGCTGAGGACTTTGTGCATGATGTGGAGCAGTCTGCTGACATAT

CCCAGAATGACGTGGAGGAGACAAGTAGGATTTTTAAACAAGGGTATGGTGCCTACCGGTGCAAGCTGTGTCCTTACACACACGGCACTCTGGAGAAACT

CAAAATCCACTATGAGAAGTACCACAACCAGCCTGAGTTTGATGTCTTTTCCCCGCCTCCTCCGAAGCTGCCAGTGTCCCTTGAACCTGAGATAACCACT

GAAGTGAGCCCCTCCCAGGTCTCCGTGACGGAGGAGGAGGTGGGAGAGGATCCTATGTCCACTGCTCACTTCTCTACCTCGCATCTGGTCTCCCACACTG

TGTTCCGGTGCCAGCTCTGCAAGTACTTCTGTTCCACTAGGAAGGGCATTGCCAGGCACTACCGGATCAAGCACAATAATGTCCGTGCCCAGCCCGAGGG

CAAAAACAATCTCTTCAAGTGTGCCCTGTGTGCCTACACCAACCCCATCCGCAAGGGACTGGCAGCCCACTACCAGAAGCGCCACGACATTGATGCATAT

TACACCCACTGCCTTGCGGCCTCCAGGACCATCAGTGACAAGCCCAACAAGGTGATCATCCCATCCCCACCCAAAGATGACTCTCCTCAGCTGAGCGAGG

AACTCCGGCGGGCTGTGGAGAAGAAAAAGTGCTCCTTATGTTCCTTCCAGTCCTTCAGCAAGAAAGGCATTGTGTCCCATTATATGAAGCGCCACCCGGG

GGTGTTCCCAAAGAAGCAGCATGCCAGCAAGTTGGGGGGCTACTTCACAGCGGTCTACGCAGATGAACACGAGAAACCCCCACTGATGGAAGAAGAGGAG

AGAAGCAGCTTTGAGAGGGCCGAGGTGGAAGGCGAAGCTCAAGACATCGAGTGGCTCCCGTTCCGCTGCATCAAATGCTTCAAGCTGTCCTTCAGCACGG

CGGAGTTGCTGTGCATGCATTACACAGACCACCACAGCAGGGACTTAAAGAGGGACTTCGTCATCCTAGGCAGCGGCCCCCGCTTCCAGAACTCCACCTT

CCAGTGTAAGCACTGTGATAGCAAATTGCAAAGCATAGCCGAGCTGACCTCACACTTGAACATCCACAATGAGGAATTCCAGAAGCGTGCCAAACGCCAG

GAGAGGAGGAAACAGCTTTTGAGCAAGCAGAAATATGCAGATGGTGCTTTTGCAGATTTCAAACAAGAGAGG - UNI222 - - UNI25164 - CCT

TTTGGTCACTTAGAAGAGGTGCCAAAGATCAAGGAGAGGAAAGTGGTGGGCTACAAGTGTAAATTCTGCGTGGAAGTGCATCCAACGCTTCGGGCCATCT

GTAACCACCTCCGGAAACATGTCCAGTATGGTAGCGTCCCGGCTGTGTCGGCTGCTGTGAAG GGGCTGCGTTCTCATGAGAGGAGCCACCTGGCCTTGG

CCATGTTTACCAGAGAGGACAAGTACAGCTGCCAGTATTGCTCCTTTGTTTCTGCATTCAGACACAA - UNI29352 - CTTGGATCGCCATATGCAG

ACCCATCACGGACACCACAAACCGTTCCGCTGCAAACTCTGCTCTTTCAAGTCCTCCTACAACAGCCGGTTGAAGACACACATCCTCAAAGCCCATGCTG

 - UNI35552 - GTGAACATGCCTACAAGTGTTCTTGGTGCTCATTTTCCACCATGACAATCAGCCAGTTGAAGGAACATTCCCTCAAGGTCCATGGC

AAAGCCCTGACCCTTCCCCGGCCACGGATTGTCAGTCTCCTCTCCTCACATGCTCACCCCTCCTCCCAGAAGGCCACTCCAGCCGAAGAAGTGGAAGACT

CCAATG - UNI17948 - ACTCCTCTTACTCGGAGCCCCCCGATGTTCAGCAGCAGCTGAATCACTACCAGTCAGCCGCCCTGGCAAGAAACAAGAGC

CGCGTTAGCCCTGTGCCTCCTTCTGGGACTGCTGCTGGCACGGAACAGAAGGCAGAAGCCGTTCTTCACTGCGAATTCTGTGAATTCTCCTCTGGCTACA

TCCAGAGCATCAGGCGCCATTACCGGGACAAGCACGGTGGGAAGAAGCTTTTCAAATGCAAAGACTGCTCCTTTTACACCGGCTTTAA - UNI3089 -

 ATCTGCTTTTACTATGCACGTGGAAGCTGGGCATTCGGCGGTCCCGGAGGAAGGCCCCAAAGATCTCCGCTGTCCTCTCTGCCTCTATCACACCAAATA

CAAACGCAACATGATCGACCACATAGTGCTGCACCGAG - UNI5712 - AAGAGCGAGTTGTCCCCATTGAAGTGTGCCGTTCCAAACTGTCAAAATA

CTTGCAGGGAGTAGTTTTCCGCTGTGATAAGTGTACCTTCACCTGCTCCAGTGACGAGAGTCTCCAGCAACACATAGAAAAGCACAATGAACTGAAACCG

TACAAATGCCAGCTCTGCTACTATGAGACCAAGCACACGGAGGAACTGGACACTCACCTTCGGGATGAGCACAAG - UNI1759 - GTGAGCCGGAAC

TTTGAGCTGGTTGGCCGGGTGAACTTGGATCAGCTGGAACAGATGAAGGAGAAGATTGAGAGTTCCAGCAGCGAGGACGAGGACAAGGACGACGAAATGA

GCAGCAAGGCTGAGGACAGAG - UNI19819 - AGCTGATGAGATTTGCAGACCGGGGGCCTGGTGTGAACACAGAGAAGCGATTTCCATGTGAATTC

TGTGGACGGGCGTTCTCACAGGGCTCTGAGTGGGAAAGACACGTGTTGAGACACGGCAT - UNI5015 - GTCATTGCATGATACCAACCAAGTGAGC

AGGAACGAAATCCATACAAAGGAGATGGTGGAGGAGAGTATGCAGCTGCCCTCCATAGAGGCCAAGGAAGACGATGAGCCAATTGGGATAGACTTTCCCT

TAAAGAGCGAAACAGTAACCATCTGTGTAGTGGCTGCCGACAAATCTCTCCTGGAGGATGCAGAGGCCAAAAACGAATAAGAGTTTGGTGAAATTCTTAT

CAAACCTTACTTGAACCGTGATGAAAATGTGGGCGGGCCGGCGTGGGCTGAGAAGGGAGGGGACAGACAGAGGAGAGAAGAAGACAGAACAAAGCTGCTT

TTAGGACTGAACAATCTATTTTCAAAGCACTGGTACCTGTGTGAGTGAGTATGTAAATTAAAGTTATTTAAATGGTTGGAATATGTGGCTCCTTTCCTGT

CACGACATCCTTCCTTCCGGATCTTCACCACGGAGATTTTCATCTGCTGCGGTTTGGGAAGTACCTCCCGTGGGCACGGTGGTCTCCGTGACCCTCTCGG

ACAGTGTGTGGAAACCGAGGCTCCCGGACACAGAAGACTTCTCCTAGGGGAACAACTTTTGGGCGCACAACTTTCTGTGCGTTTTTCTAGTTTTAATACC

TTAAGCTTTTTCAAGACCTAACTGCAGCCGCTTTGGGAGAAAAAAAAATAACAAAACAGAAAACAAACAAAAAAAAACTGCTTTGCATAAAACAGTCACC

TGTTTCCTAGTACCTCAGACTTAACCAAGGGAATTCTCTGCATTTGTCTGTACTACCTGTGGCCCTTGTGGTTAAATGTAGAGAGAACTGCTGGACAGGA

TGGTGAATGGAGAAAAAAAAAGAGTTTTAAAGAAAGGAACACAAATTGTGCTTAAAATCCCCACGTGGGTTTTATTTCTTAAAATACTGTGATTTTTTTA

ATTATTTTAGTAAAAAACAAAACAAAAAAAAAAGAAACAGACTTTAATTACTAGATAACTGTGTGTGAATTGTCATCTTGTATTCCAGGTAAGCTGTTTA

TTAGTGTTCAGCTATAATTTAGAATTTGGTAGGTTCATGTGAACTAATTTTATGGTGATCGTGGGATTTCGTTGGCCACATGTTTATTTTTTTCTCGATT

TGAGTGTTACAAACACAGCACAAATTCAGTTGTTCTTTCTTCATATGAGTTGTTCTCTGTGTGTTTGTTTAATTTGAGGTCAAGGGAGAGTTAGAGGGTG

TAGGGTGTGTGTGTGTATGTATGTGTGTGTGTGTGAATTTTTATAATTTTAAACATGAACATAACAAAGAGGTTAACTTCCTTTTAAATTTGTTTTTGTG

TTTGTTTGCTTTTTAATTTAACTAAAGAACCAAACTCCGAGCACAGCTATGCAGTGGGGGGGGCCAGACAAGGAGGTCCCGTCACCCTTTTGGGTTTGTT

TGTTTTTTTTTTTTCTCAAAGCAACACATTTCGTCTCCCCAACGATTTCTGTTACATTGGGCTGGCCTTCGTGTGTGCTGTGAACTCTGTTTTGTTTGCT

TTGTGTATTGTGAGGCTGTCTCATTTCTTTGGGGAGCCATCCCTTCCGTGAGCTTGGACAGGAGATGCCGCATCCTGCAGGGAGCCTGGAAAAGTGCTTT

GTCTGCGCATCTAGCTGCTCTGTTTCCCCACAGTGGCTTCGTTTATTTTATTTTATTTTTTTCCAAGAGCAGCTTAGACTGAAAGCAAGTCTACATTTAT

AGCACATTATGATTGTGAAAATGGGGTTTTGTTCCAAAAAGTGGAAAGGAACATTCTTGAAGCTTAGGGGCGTGTGTGTGTGGGTGGGTGGGTGTGTGCG

CGTGCGCACATACGTGTGCTGGTGTTTGGATGTATGTGTGTGGGCAAATATGAGTCCTAGGTTTTGTTTCTTTTGTTGTCCTTGTTTGGGTTTTTGTTTG

TTTGTTTTTTTTAACTTGGAAGGGTTGATGGGGTGGGGGGCGGGCCAGAAGGGAAAGAGGGTAAACTGAGGTGTCAGTGTCCCACACAGCTTCAGAGAAA

ATCCATGGAAAGATATCGCATTTGTGAAGTAAGTACGTACTTGAAAAGCATGATCTTGGTTTTGCTTTGTTTTTATTTTTTATTTTTGTTTTTATTTTTG

ATTTTTAGTTTTTGCTATTAAGAATTTTTATTTGTAGGATGTTTAATTTAATTTTGTTTTTAGGGATGGGGCCGTCATGTGGAAACCAGAACAGGGGGAA

GTGTGAAATATCTAGACAGATTCTTCTGTGTCCTTACTCGCTTTTGATTGGCCTCATTTCAAATGTACTAAACAGTTTCATACCTGGACTGGATGTCTGT

GATGGTTACCAAAAACAAACAAAACAACGAAAGGAAAAGAGAAAATAATTGTGACATGCTTCTATCACTACTTTATTTTTCAAATAACATGTAAATATTG

TAATCCATTGGATTTTGTTTTGCTAACCTGATAATAAAAATATGGGACCATTATCCTTTTAACAAGGCTAGGATGTCATTTTTTTGTTTTATTTTTCAAA

CATATACCTGATATTTTGTGGCCGCACATTTTGGACGCATTCTGTTTTCTGTTGACTGTAATGACATAGAATTTACAAAATTTTTTGTTGTTGTTGTTTA

ATTTATACAGAGGACATTTTTTTTTCCAGAGCTTGAGAGAAGAAAATAAATAGCAAAATGATAACCTATTGACTCCAATAATCAGTGTTTCCTGAAACTT

GATGAAAGATAGGGGGATCCTGACTCCTTGAAGCCAAGGGTTTAAACACAAAAAAAATAAAATAAAAAAATAAATAAAAATAAAAAACACAAGTAGGTTA

TTCAAGTTGTTTGCAACATACATTTTGTAATGAGATGTGAGAAATTAATAAAGAATTTTTTTCACATGT
Translation
 - UNI2859 - MEVLQCDGCDFRAPSYEDLKAHIQDVHTAFLQPTDVAEDNDDEPLSGSMNASNQTEVEFSSIKDEFVIAEDLPG - UNI12349 -

 - UNI25164 - GQSATALGSGGYYGHSPGYYGQHITPNPKPTNKFFQCKFCVRYFRSKNLLIEHTRKVHGAQAEESPTGPPVPGSLNYNIMMHEGFG

KVFSCQFCTYKSPRRARIIKHQKMYHKNSLKESTAPPPAPAPLPDPLVPPVSLQDPCKELPAEVVERSILESMVKPLTKSRGNFCCEWCSYQTPRRERWC

DHMMKKHRSMVKILSSIRQQEGPNVSEAQNDNEPSPTSNSTYLSMNAASREMPNANVSNFRGSMGNSIMRPNSSSTSKFSSSMSYPQMKPKSPHNSGLVN

LTERSRYGMSDMTNSSADLDTNSMLNDSSSDEDLNEVDSENGLSVLDHQASGLSAEQLMGSDGNKLLETKGIPFRRFMNRFQCPFCPFLTMHRRSISRHI

ENIHLSGKTAVYKCDECPFTCKSSLKLGAHKQCHTGTSDWDTVNSQSESLSSSLNEGMVSYESSSINGRKSGVMLDPLQQQQPPQPPPPLPPPPPPPSQP

LPQPPPPPLQSPHQVPPPTQQPQPPTQAPPLHPYKCTMCSYSTMTLKGLRVHQQHKHSFCDNLPKFEGQPSSLPLENETDSHPSSSNTVKKSQTSILGLS

SKNNFVAKANRKLASDFPLDLSPVKKRTRIDEIASNLQSKINQTKLQEDAIINVEDDEEEEDDNEVEIEVELDREEEATDPIMEVPTAFSAQQIWARDAS

EAQKEPNYRSITHDYTATNGAEIELTLSEDEEDYYGSSASMKDQVSNAALLNTQPAIYGTEPSNENTDFGDSGRLYYCKHCDFNNKSARSVSTHYQRMHP

YIKFSFRYILDPNDHSAVYRCLECYIDYTNFEDLQQHYGEHHPEAMNVLNFDHSDLIYRCRFCSYTSPNVRSLMPHYQRMHPTVKINNAMIFSSYVVEQQ

EGLNAESQTLREILNSAPKSMATSTPVARGGGLPATFNKNTPPKTFTPECESQKDPSVNTVVVYDCDVCSFASPNMHSVLVHYQKKHPEEKASYFRIQKT

MRMVSVDRGSALSQLSFEVGAPMSPKMSNMGSPPPPQPPPPDLSIELYYCKHCSYSNRSVVGVLVHYQKRHPEIKVTAKYIRQAPPTAAMMRGAEGLQDS

PRPPAPLQLNSSERDCPPVETEMFFCQHCDYGNRTVKGVLIHYQKKHRDFKANADVIRQHTATIRSLCDRNQKPASCVLLPASGMERDKTKLRALKCRQC

SYTSPYFYALRKHIKKDHPALKATVTSIMRWAFLDGLIEAGYHCEWCIYSHMEPSGLLLHYQRRHPEHYVDYTYMATKLWAGPDPSSPTLTMSAEAKTYR

CRDCVFEAVSIWDITNHYQAFHPWAMNGDESVLLDIIKEKDGVDKALLAPEELIGPVNCENSIPNPLPEQEAECPEDARLSPEKSIHLASANPAISSTPY

QCTVCQSEYNNLHGLLTHYGKKHPGMKVKAADFAQDIDINPGAVYKCRHCPYINTRIHGVLTHYQKRHPAIKVTAEDFVHDVEQSADISQNDVEETSRIF

KQGYGAYRCKLCPYTHGTLEKLKIHYEKYHNQPEFDVFSPPPPKLPVSLEPEITTEVSPSQVSVTEEEVGEDPMSTAHFSTSHLVSHTVFRCQLCKYFCS

TRKGIARHYRIKHNNVRAQPEGKNNLFKCALCAYTNPIRKGLAAHYQKRHDIDAYYTHCLAASRTISDKPNKVIIPSPPKDDSPQLSEELRRAVEKKKCS

LCSFQSFSKKGIVSHYMKRHPGVFPKKQHASKLGGYFTAVYADEHEKPPLMEEEERSSFERAEVEGEAQDIEWLPFRCIKCFKLSFSTAELLCMHYTDHH

SRDLKRDFVILGSGPRFQNSTFQCKHCDSKLQSIAELTSHLNIHNEEFQKRAKRQERRKQLLSKQKYADGAFADFKQER - UNI222 - - UNI2516

4 - PFGHLEEVPKIKERKVVGYKCKFCVEVHPTLRAICNHLRKHVQYGSVPAVSAAVK GLRSHERSHLALAMFTREDKYSCQYCSFVSAFRHN - UN

I29352 - NLDRHMQTHHGHHKPFRCKLCSFKSSYNSRLKTHILKAHAG - UNI35552 - GEHAYKCSWCSFSTMTISQLKEHSLKVHGKALTLPR

PRIVSLLSSHAHPSSQKATPAEEVEDSND - UNI17948 - DSSYSEPPDVQQQLNHYQSAALARNKSRVSPVPPSGTAAGTEQKAEAVLHCEFCEFS

SGYIQSIRRHYRDKHGGKKLFKCKDCSFYTGFK - UNI3089 - KSAFTMHVEAGHSAVPEEGPKDLRCPLCLYHTKYKRNMIDHIVLHRE - UNI5

712 - EERVVPIEVCRSKLSKYLQGVVFRCDKCTFTCSSDESLQQHIEKHNELKPYKCQLCYYETKHTEELDTHLRDEHK - UNI1759 - VSRNFE

LVGRVNLDQLEQMKEKIESSSSEDEDKDDEMSSKAEDRE - UNI19819 - ELMRFADRGPGVNTEKRFPCEFCGRAFSQGSEWERHVLRHGM - UN

I5015 - MSLHDTNQVSRNEIHTKEMVEESMQLPSIEAKEDDEPIGIDFPLKSETVTICVVAADKSLLEDAEAKNE

For any suggestions or comments, please send an email to unitrap@crg.es