Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000060475 (Wtap)
Chromosomal location
Chr 17: 13159669 - 13185021 (-)
Description
Wilms' tumour 1-associating protein Gene [Source:MGI Symbol;Acc:MGI:1926395]
RefSeq_peptide
NP_780603.1 NP_001107004.1 NP_001107005.1 
UniGene
Mm.392668 
MGI
MGI:1926395 
Uniprot/SWISSPROT
Q9ER69 
Uniprot/SPTREMBL
Q566J5 Q571E0 
Human Ortholog
ENSG00000146457 (WTAP)
Omim not available
UniTrap UNI12184
Vector Insertion
Chr 17: 13178820 - 13184942
Public Clones (sanger) P148G07 (ggtc) P125F08 (ggtc) P107D07 (ggtc) E080D06 (ggtc)
D035D02 (ggtc) P148C03 (ggtc) P117H02 (ggtc) P094B02 (ggtc) D107B02 (ggtc)
D015D09 (ggtc) 5SE286B12 (ggtc) P134A08 (ggtc) P115B06 (ggtc) H002A02 (ggtc)
D039G06 (ggtc) D006E03 (ggtc) P148G06 (ggtc) P118F02 (ggtc) P099F07 (ggtc)
D178A02 (ggtc) D029C10 (ggtc) W238D05 (ggtc) P117F11 (ggtc) D048H06 (ggtc)
D008B11 (ggtc) 3SE307F05 (ggtc) E086F04 (ggtc) D037H05 (ggtc) D025H03 (ggtc)
P139A09 (ggtc) P093C03 (ggtc) D040C04 (ggtc) 3SE307B06 (ggtc) PST14506-NL (escells)
PST8713-NL (escells) PST21088-NR (escells) PST17751-NR (escells) PST11837-NR (escells)
PST4223-NL (escells) PST22352-NR (escells) PST18 (escells) PST11233-NR (escells)
PST22312-NL (escells) PST17887-NL (escells) PST12569-NL (escells) PST6639-NR (escells)
PST22079-NR (escells) PST17235-NR (escells) PST5540-NR (escells) PST543-1 (escells)
PST19197-NR (escells) PST4926-NR (escells) PST0006-NL (escells) PST22169-NL (escells)
PST17788-NR (escells) PST11877-NL (escells) PST5079-NL (escells) PST21966-NR (escells)
PST12527-NR (escells) PST3363-NL (escells) PST1282-2 (escells) PST18107-NR (escells)
PSTVU02.52B (vanderbilt) IST15001D10 (tigm) IST10931F5 (tigm) IST14114A4 (tigm)
IST10074D11 (tigm)
Private Clones OST461911 (lexicon) OST415126 (lexicon) OST406652 (lexicon) OST405307 (lexicon)
OST345691 (lexicon) OST323759 (lexicon) OST310407 (lexicon) OST274626 (lexicon)
OST272006 (lexicon) OST234732 (lexicon) OST225995 (lexicon) OST223142 (lexicon)
OST215818 (lexicon) OST193528 (lexicon) OST176901 (lexicon) OST158171 (lexicon)
OST149144 (lexicon) OST125951 (lexicon) OST102868 (lexicon) OST100556 (lexicon)
OST85385 (lexicon) OST39932 (lexicon) OST33748 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15971
Vector Insertion
Chr 17: 13176379 - 13178781
Public Clones (sanger) D044C06 (ggtc) D091F02 (ggtc) PST19400-NR (escells) IST14193B6 (tigm)
Private Clones OST469150 (lexicon) OST456366 (lexicon) OST439624 (lexicon) OST383798 (lexicon)
OST297434 (lexicon) OST278071 (lexicon) OST272022 (lexicon) OST269584 (lexicon)
OST261228 (lexicon) OST218196 (lexicon) OST210061 (lexicon) OST198615 (lexicon)
OST181832 (lexicon) OST174671 (lexicon) OST133618 (lexicon) OST130985 (lexicon)
OST126481 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7167
Vector Insertion
Chr 17: 13174675 - 13176322
Public Clones RRU410 (baygenomics)
Private Clones OST243806 (lexicon) OST234733 (lexicon) OST218664 (lexicon) OST200529 (lexicon)
OST111037 (lexicon) OST58069 (lexicon)
Severity of mutation (?) Insertion after 7% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI10791
Vector Insertion
Chr 17: 13173816 - 13174615
Public Clones 3SP148C09 (ggtc) P148C09 (ggtc) 5SP148C09 (ggtc) (egtc)
Private Clones not available
Severity of mutation (?) Insertion after 13% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI7849
Vector Insertion
Chr 17: 13168341 - 13173687
Public Clones RRP098 (baygenomics) CMHD-GT_384C6-3 (cmhd)
Private Clones OST286217 (lexicon) OST50492 (lexicon)
Severity of mutation (?) Insertion after 23% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000007007
Sequence
GAGGAGCGCGGGGGGGCCGGCGGCGGCGCGGCCTCGGCCTGTGTGACTGGCGGCGCCCGCGCAGCCTCGGGCTGGGAAG - UNI12184 - GGTGCAA

GATGACCAACGAAGAACCTCTTCCTAAAAAG - UNI15971 - GTCCGACTGAGTGAAACAGACTTCAAAGTTATGGCACGGGATGAGTTAATTCTAA

G - UNI7167 - ATGGAAACAATATGAAGCATATGTTCAAGCTTTGGAGGGAAAGTACACAGATCTTAATT - UNI10791 - CAAACGATGTGAC

TGGTTTAAGGGAATCTGAAGAAAAACTAAAGCAGCAACAGCAGGAGTCTGCACGCAGGGAGAACATTCTTGTCATGCGGCTAGCAACCAAAGAGCAGGAG

ATGCAAGAGTGCACC - UNI7849 - ACTCAAATCCAGTACCTCAAGCAAGTTCAGCAGCCGAGTGTGGCCCAACTGAGATCAACAATGGTAGACCCA

GCAATCAACTTGTTTTTCCTAAAAATGAAAGGTGAACTGGAACAGACTAAAGACAAACTGGAACAAGCCCAAAATGAACTGAGTGCCTGGAAGTTTACGC

CTGATAG CCAAACAGGCAAAAAGCTAATGGCGAAGTGTCGAATGCTTATCCAGGAGAACCAAGAGCTTGGAAGGCAGCTGTCCCAGGGCCGTATTGCAC

AGCTTGAAGCAGAATTGGCTTTACAGAAGAAATATAGTGAGGAGCTTAAAAGCAGTCAGGATG AACTGAATGACTTCATCATTCAACTTGATGAAGAAG

TAGAGGGTATGCAGAGCACCATTCTAGTTCTTCAGCAACAATTGAAGGAGACACGACAGCAGTTGGCACAGTACCAGCAGCAGCAGTCTCAAGCTTCAGC

TCCAAGTACCAGCAGGACTACATCTTCTGAACCTGTAGATCAGGCAGAGGTCACAAGCAAAGACTGCAGTCGTCTGGCAAATGGACCAAGTAATGGCAGC

TCCTCCCGCCAGAGGACGTCTGGGTCTGGATTTCACAGGGAGGGGAGCACACCTGAGGATGACTTTCCTTCTTCTTCAGGGAATGGTAATAAGGCCTCCA

ACAGCTCAGAGGAGAGAACTGGCAGAGGAGGTAGTAGTTACATAAACCCACTCAGTGCGGGGTATGAAAGTGTAGACTCTCCCACGGGCAGTGAAAACTC

TCTCACACATCACTCAAATGACACAGACTCCAGTCATGACCCTCAAGAGGAGAAAGCAGTGAGTGGGAAAGGTAATCGAACTGTGGGTTCCCGCCATGTT

CAGAATGGCTTGGACTCAAATGTAAATGTACAGGGTGCAGTTTTGTAATATTTTTCCAGAAAATTTTTATACAGTGTCATTTAATTGGGGAAAGGATACT

GTCAAAAAATTAATGCATACTTTTGTCACAATTTACCTTTTTGTGGGTGTGTTTTTGTTTTGTTTGGTTCCTTTTTTTTTTTTTTTTTTTTTTTTTTTTT

TTTTTTTTTAATTGCTTCAATACCTCTGCCACTTTGAAAATTGTAACAGTTAATTACTTTGAACATTGCTAAAAGGACATTTTGTGTAGGGTCAAGTTAT

TTTTATATGAGTTAATGTGAAGTTGTAAATGGGAATCTATAGCAATGATGTCTGTATAAATCTGTCTTATCTAGAACTTGTGCTGTCAGGGCACTCTTCC

TCACGCTGTTGTTACTCATGCACCATTCAGACTTGTTAGAGTAGATGTGGGTTTAGGACTGCCAGGTTTGCCCAGTATAGTAGTTTTTATCACTAAAAAG

TTGGACTTGGAGTCCTATAGTAGTTTCAGCGTTAGATAAAGTTTTTCCACCATACATCTTTAGGTGCATTCATCTTTAGGTGACTGAATGTTAAGAAATC

TGTGTGCATAGTTACTAAGTTTTTATGAACTGTTGTGTCCTGTTAATGCATATTGCCCTGTGACTCCAGTATATCTCACCTGTACTGACCAAACCTAAAT

AAACATTTTTATT
Translation
 - UNI12184 - MTNEEPLPKK - UNI15971 - VRLSETDFKVMARDELILR - UNI7167 - RWKQYEAYVQALEGKYTDLNS - UNI107

91 - SNDVTGLRESEEKLKQQQQESARRENILVMRLATKEQEMQECT - UNI7849 - TQIQYLKQVQQPSVAQLRSTMVDPAINLFFLKMKGELEQ

TKDKLEQAQNELSAWKFTPDS SQTGKKLMAKCRMLIQENQELGRQLSQGRIAQLEAELALQKKYSEELKSSQDE ELNDFIIQLDEEVEGMQSTILVLQ

QQLKETRQQLAQYQQQQSQASAPSTSRTTSSEPVDQAEVTSKDCSRLANGPSNGSSSRQRTSGSGFHREGSTPEDDFPSSSGNGNKASNSSEERTGRGGS

SYINPLSAGYESVDSPTGSENSLTHHSNDTDSSHDPQEEKAVSGKGNRTVGSRHVQNGLDSNVNVQGAVL

For any suggestions or comments, please send an email to unitrap@crg.es