Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000060508 (Nlrp9b)
Chromosomal location
Chr 7: 20593383 - 20658655 (+)
Description
NLR family, pyrin domain containing 9B Gene [Source:MGI (curated);Acc:Nlrp9b-002]
Human Ortholog
not available
Omim not available
UniTrap UNI35727
Vector Insertion
Chr 7: 20593443 - 20604520
Public Clones IST14555H4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000073151
Sequence
GAGCATGTGTGCAGTTGTTGCTTGAAAATGGATTCTCAGTGTTGAAAATTTGGGACAAAG - UNI35727 - GTATCACTTATGTCTTTGTTTTGAAG

ATTATCAAGCTCTGGAATCTGAGATCATTGTTGAAGATGGCGGGCTCATCTGGCTATGGCTTGCTGAAGCTTCTGCAAAAACTGAGTGATGAGGAGTTCC

AGAGATTTAAAGAGCTTCTCAGAGAAGAGCCTGAAAAGTTTAAACTCAAACCAATATCCTGGACGAAAATCGAGAATTCTTCCAAAGAAAGCCTGGTAAC

GCTATTGAACACACATTATCCAGGACAGGCATGGAATATGATGTTAAGCCTGTTTCTACAGGTCAATCGGGAAGACCTCTCAATCATGGCTCAGAAAAAG

AAGAGAC ATAAACAAACTAAATACAAAAAGTTTATGAAGACTACATTTGAAAGGATATGGACATTGGAGACCAACACTCATATACCTGATAGAAACTAC

CATTTAATTGTAGAAGTCCAGTACAAAGCATTGCAGGAAATATTTGATTCTGAGTCAGAGCCAGTCACTGCAATTGTAGCAGGTACAACAGGAGAAGGAA

AAACCACTTTCTTAAGAAAAGCAATGTTGGATTGGGCATCAGGAGTTTTACTGCAGAACCGGTTTCAGTATGTTTTCTTCTTCTCTGTCTTCTCACTTAA

CAATACCACAGAGTTAAGCTTAGCCGAGCTTATCTCAAGTACGTTGCCTGAATCTTCAGAGACAGTGGATGATATTTTATCTGATCCAAAAAGAATCTTG

TTTATCCTGGATGGATTTGATTACCTGAAATTTGACTTGGAACTCAGGACAAACTTGTGCAATGACTGGAGGAAGAGGCTGCCAACACAAATCGTCTTGA

GTAGTTTGCTACAGAAAATAATGCTCCCGGGATGTTCTCTGCTTCTTGAATTGGGACAAATAAGTGTACCAAAAATCCGTCATTTGCTGAAGTATCCAAG

GGTGATAACTATGCAAGGATTCTCTGAGCGGTCTGTAGAGTTCTATTGTATGTCCTTCTTTGATAACCAGAGAGGCATAGAAGTAGCTGAGAATTTAAGG

AATAATGAAGTACTCCATTTATGCAGCAATCCTTATCTATGCTGGATGTTCTGTAGTTGTTTAAAGTGGCAGTTTGACAGGGAGGAGGAAGGGTACTTTA

AGGCTAAAACAGATGCGGCTTTCTTCACAAACTTTATGGTGAGTGCATTCAAATCAACATATGCCCATAGTCCGTCCAAACAGAACAGAGCCCGATTAAA

GACCCTGTGTACCTTGGCTGTAGAAGGAATGTGGAAAGAGTTGTTTGTCTTTGACTCTGAAGATCTCAGGAGGAATGGGATATCTGAATCCGATAAGGCA

GTGTGGCTGAAAATGCAATTTCTCCAGACTCACGGTAACCACACTGTGTTTTATCATCCTACACTACAGTCATATTTTGCTGCCATGTTCTATTTCCTCA

AACAAGACAAAGACATATGTGTCCCAGTCATTGGAAGCATACCTCAACTTCTAGGAAACATGTATGCTCGTGGCCAGACCCAGTGGCTCCAGTTAGGCAC

ATTTTTGTTTGGACTCATCAATGAACAAGTCGCCGCCTTACTCCAACCATGCTTTGGCTTTATACAACCCATATATGTAAGACAGGAAATCATTTGTTAC

TTTAAGTGTCTTGGTCAACAAGAGTGCAATGAGAAACTGGAAAGATCCCAGACTTTGTTCTCCTGTCTGCGTGACAGCCAGGAGGAAAGATTTGTTAGAC

AAGTGGTGGATCTACTTGAAGAAATTACTGTTGATATTAGTAGTTCAGATGTATTATCAGTGACTGCATATGCTCTGCAGAAATCCTCCAAATTAAAGAA

ACTTCATCTGCATATACAAAAGACAGTTTTTTCAGAAATCTACTGCCCAGACCATTGTAAAACAAGAACTTCTATAGGCAAAAGACG AAATACAGCCGA

ATATTGGAAAACATTATGTGGCATTTTCTGCAACTTATATGTGTTGGATCTGGACAGCTGTCAGTTCAATAAAAGGGCCATACAGGACCTCTGTAATTCG

ATGTCTCCAACTCCTACGGTGCCCCTGACTGCTTTTAAGCTCCAAAGCTTGTC GTGTTCCTTCATGGCTGACTTTGGAGATGGTTCATTATTTCACACC

CTTCTTCAGCTACCTCACCTGAAATACCTGAACCTGTATGGCACTTATCTCTCCATGGATGTGACTGAGAAGCTGTGTGCTGCTCTGAGATGCTCAGCAT

GCAGAGTGGAGGAGCTGCT GTTGGGTAAATGTGGCATCTCAAGTAAGGCCTGTGGCATAATTGCGATTTCCCTTATCAACTCTAAAGTGAAACACCTCT

CATTGGTTGAAAATCCCTTGAAGAACAAAGGAGTGATGTCACTGTGTGAAATGCTGAAGGATCCAAGCTGTGTCCTGCAGTCACTGAT GTTGTCTTACT

GCTGCCTCACATTCATTGCCTGTGGACATCTCTATGAAGCACTTTTGAGCAACAAACACCTCTCCCTGCTTGATCTGGGATCAAATTTCCTGGAAGATAC

TGGAGTGAACCTTCTGTGTGAAGCTTTGAAAGATCCAAACTGCACCCTCAAGGAGTTATG GTTGCCGGGTTGCTTTTTAACTTCACAATGCTGTGAGGA

GATCTCGGCTGTCCTCATTTGCAATAGAAATCTAAAGACCCTGAAACTGGGCAACAATAACATACAAGACACTGGTGTCAGACAGTTATGTGAAGCTCTG

AGTCATCCCAACTGTAACTTGGAGTGTCTTGG GTTAGACCTGTGTGAGTTCACCAGTGACTGTTGTAAGGACCTAGCCTTGGCTCTCACCACCTGCAAA

ACACTGAATAGCTTAAATCTGGACTGGAAAACCTTGGACCACTCTGGGCTGGTGGTGCTCTGTGAGGCTTTGAATCACAAAAGATGTAACCTGAAGATGC

TTGG ACTGGACAAATCTGCGTTTTCCGAGGAATCACAGACATTACTGCAAGATGTGGAAAAGAAAAATAATAATCTGAATATTTTGCATCATCCCTGGT

TTGAGGCGGAACGCAACAAGAGGGGTACTCGTCTGGTATGGAACAGCAGGAATTGATCTGTGACAAAGGCTTATCCTCTGTTATGTTTCTCCCATATACC

CTGCCCCAAGTTGCACACCATGGTACTGGTGGCTGTTTCCAGGGCTGTTCTTCCACATTGTCCCACCCCCACCCCCACCCATCTACACATCTCCCCGCAT

CACTTTGCAATGTTTATATTACAAGCACATTTAATAAACACTAAGCGTGTTTGAAAA
Translation
 - UNI35727 - MAGSSGYGLLKLLQKLSDEEFQRFKELLREEPEKFKLKPISWTKIENSSKESLVTLLNTHYPGQAWNMMLSLFLQVNREDLSIMAQ

KKKRH HKQTKYKKFMKTTFERIWTLETNTHIPDRNYHLIVEVQYKALQEIFDSESEPVTAIVAGTTGEGKTTFLRKAMLDWASGVLLQNRFQYVFFFSV

FSLNNTTELSLAELISSTLPESSETVDDILSDPKRILFILDGFDYLKFDLELRTNLCNDWRKRLPTQIVLSSLLQKIMLPGCSLLLELGQISVPKIRHLL

KYPRVITMQGFSERSVEFYCMSFFDNQRGIEVAENLRNNEVLHLCSNPYLCWMFCSCLKWQFDREEEGYFKAKTDAAFFTNFMVSAFKSTYAHSPSKQNR

ARLKTLCTLAVEGMWKELFVFDSEDLRRNGISESDKAVWLKMQFLQTHGNHTVFYHPTLQSYFAAMFYFLKQDKDICVPVIGSIPQLLGNMYARGQTQWL

QLGTFLFGLINEQVAALLQPCFGFIQPIYVRQEIICYFKCLGQQECNEKLERSQTLFSCLRDSQEERFVRQVVDLLEEITVDISSSDVLSVTAYALQKSS

KLKKLHLHIQKTVFSEIYCPDHCKTRTSIGKRR RNTAEYWKTLCGIFCNLYVLDLDSCQFNKRAIQDLCNSMSPTPTVPLTAFKLQSLS SCSFMADFG

DGSLFHTLLQLPHLKYLNLYGTYLSMDVTEKLCAALRCSACRVEELL LLGKCGISSKACGIIAISLINSKVKHLSLVENPLKNKGVMSLCEMLKDPSCV

LQSLM MLSYCCLTFIACGHLYEALLSNKHLSLLDLGSNFLEDTGVNLLCEALKDPNCTLKELW WLPGCFLTSQCCEEISAVLICNRNLKTLKLGNNNI

QDTGVRQLCEALSHPNCNLECLG GLDLCEFTSDCCKDLALALTTCKTLNSLNLDWKTLDHSGLVVLCEALNHKRCNLKMLG GLDKSAFSEESQTLLQD

VEKKNNNLNILHHPWFEAERNKRGTRLVWNSRN
Transcript ENSMUST00000117909
Sequence
ATGGCGGGCTCATCTGGCTATGGCTTGCTGAAGCTTCTGCAAAAACTGAGTGATGAGGAGTTCCAGAGATTTAAAGAGCTTCTCAGAGAAGAGCCTGAAA

AGTTTAAACTCAAACCAATATCCTGGACGAAAATCGAGAATTCTTCCAAAGAAAGCCTGGTAACGCTATTGAACACACATTATCCAGGACAGGCATGGAA

TATGATGTTAAGCCTGTTTCTACAGGTCAATCGGGAAGACCTCTCAATCATGGCTCAGAAAAAGAAGAGAC ATAAACAAACTAAATACAAAAAGTTTAT

GAAGACTACATTTGAAAGGATATGGACATTGGAGACCAACACTCATATACCTGATAGAAACTACCATTTAATTGTAGAAGTCCAGTACAAAGCATTGCAG

GAAATATTTGATTCTGAGTCAGAGCCAGTCACTGCAATTGTAGCAGGTACAACAGGAGAAGGAAAAACCACTTTCTTAAGAAAAGCAATGTTGGATTGGG

CATCAGGAGTTTTACTGCAGAACCGGTTTCA AAATACAGCCGAATATTGGAAAACATTATGTGGCATTTTCTGCAACTTATATGTGTTGGATCTGGACA

GCTGTCAGTTCAATAAAAGGGCCATACAGGACCTCTGTAATTCGATGTCTCCAACTCCTACGGTGCCCCTGACTGCTTTTAAGCTCCAAAGCTTGTC GT

GTTCCTTCATGGCTGACTTTGGAGATGGTTCATTATTTCACACCCTTCTTCAGCTACCTCACCTGAAATACCTGAACCTGTATGGCACTTATCTCTCCAT

GGATGTGACTGAGAAGCTGTGTGCTGCTCTGAGATGCTCAGCATGCAGAGTGGAGGAGCTGCT GTTGGGTAAATGTGGCATCTCAAGTAAGGCCTGTGG

CATAATTGCGATTTCCCTTATCAACTCTAAAGTGAAACACCTCTCATTGGTTGAAAATCCCTTGAAGAACAAAGGAGTGATGTCACTGTGTGAAATGCTG

AAGGATCCAAGCTGTGTCCTGCAGTCACTGAT GTTGTCTTACTGCTGCCTCACATTCATTGCCTGTGGACATCTCTATGAAGCACTTTTGAGCAACAAA

CACCTCTCCCTGCTTGATCTGGGATCAAATTTCCTGGAAGATACTGGAGTGAACCTTCTGTGTGAAGCTTTGAAAGATCCAAACTGCACCCTCAAGGAGT

TATG GTTAGACCTGTGTGAGTTCACCAGTGACTGTTGTAAGGACCTAGCCTTGGCTCTCACCACCTGCAAAACACTGAATAGCTTAAATCTGGACTGGA

AAACCTTGGACCACTCTGGGCTGGTGGTGCTCTGTGAGGCTTTGAATCACAAAAGATGTAACCTGAAGATGCTTGG CAGTGGAGAGTTAATGTTTCTCA

TGAAGTGGAAGGACTCAGATGAGGCTGACTTGGTACAGGCAAAGGAGGCAAATATGATATGTCCTCAGATTGTAATTTCCTTCTATGGGGAGAGGCTGAC

TTGGCATTCTTGA
Translation
MAGSSGYGLLKLLQKLSDEEFQRFKELLREEPEKFKLKPISWTKIENSSKESLVTLLNTHYPGQAWNMMLSLFLQVNREDLSIMAQKKKRH HKQTKYKK

FMKTTFERIWTLETNTHIPDRNYHLIVEVQYKALQEIFDSESEPVTAIVAGTTGEGKTTFLRKAMLDWASGVLLQNRFQ QNTAEYWKTLCGIFCNLYVL

DLDSCQFNKRAIQDLCNSMSPTPTVPLTAFKLQSLS SCSFMADFGDGSLFHTLLQLPHLKYLNLYGTYLSMDVTEKLCAALRCSACRVEELL LLGKCG

ISSKACGIIAISLINSKVKHLSLVENPLKNKGVMSLCEMLKDPSCVLQSLM MLSYCCLTFIACGHLYEALLSNKHLSLLDLGSNFLEDTGVNLLCEALK

DPNCTLKELW WLDLCEFTSDCCKDLALALTTCKTLNSLNLDWKTLDHSGLVVLCEALNHKRCNLKMLG GSGELMFLMKWKDSDEADLVQAKEANMICP

QIVISFYGERLTWHS
Transcript ENSMUST00000094751
Sequence
GAGCATGTGTGCAGTTGTTGCTTGAAAATGGATTCTCAGTGTTGAAAATTTGGGACAAAG - UNI35727 - GTATCACTTATGTCTTTGTTTTGAAG

ATTATCAAGCTCTGGAATCTGAGATCATTGTTGAAGATGGCGGGCTCATCTGGCTATGGCTTGCTGAAGCTTCTGCAAAAACTGAGTGATGAGGAGTTCC

AGAGATTTAAAGAGCTTCTCAGAGAAGAGCCTGAAAAGTTTAAACTCAAACCAATATCCTGGACGAAAATCGAGAATTCTTCCAAAGAAAGCCTGGTAAC

GCTATTGAACACACATTATCCAGGACAGGCATGGAATATGATGTTAAGCCTGTTTCTACAGGTCAATCGGGAAGACCTCTCAATCATGGCTCAGAAAAAG

AAGAGAC ATAAACAAACTAAATACAAAAAGTTTATGAAGACTACATTTGAAAGGATATGGACATTGGAGACCAACACTCATATACCTGATAGAAACTAC

CATTTAATTGTAGAAGTCCAGTACAAAGCATTGCAGGAAATATTTGATTCTGAGTCAGAGCCAGTCACTGCAATTGTAGCAGGTACAACAGGAGAAGGAA

AAACCACTTTCTTAAGAAAAGCAATGTTGGATTGGGCATCAGGAGTTTTACTGCAGAACCGGTTTCA AAATACAGCCGAATATTGGAAAACATTATGTG

GCATTTTCTGCAACTTATATGTGTTGGATCTGGACAGCTGTCAGTTCAATAAAAGGGCCATACAGGACCTCTGTAATTCGATGTCTCCAACTCCTACGGT

GCCCCTGACTGCTTTTAAGCTCCAAAGCTTGTC GTGTTCCTTCATGGCTGACTTTGGAGATGGTTCATTATTTCACACCCTTCTTCAGCTACCTCACCT

GAAATACCTGAACCTGTATGGCACTTATCTCTCCATGGATGTGACTGAGAAGCTGTGTGCTGCTCTGAGATGCTCAGCATGCAGAGTGGAGGAGCTGCT 

GTTGGGTAAATGTGGCATCTCAAGTAAGGCCTGTGGCATAATTGCGATTTCCCTTATCAACTCTAAAGTGAAACACCTCTCATTGGTTGAAAATCCCTTG

AAGAACAAAGGAGTGATGTCACTGTGTGAAATGCTGAAGGATCCAAGCTGTGTCCTGCAGTCACTGAT GTTGTCTTACTGCTGCCTCACATTCATTGCC

TGTGGACATCTCTATGAAGCACTTTTGAGCAACAAACACCTCTCCCTGCTTGATCTGGGATCAAATTTCCTGGAAGATACTGGAGTGAACCTTCTGTGTG

AAGCTTTGAAAGATCCAAACTGCACCCTCAAGGAGTTATG GTTAGACCTGTGTGAGTTCACCAGTGACTGTTGTAAGGACCTAGCCTTGGCTCTCACCA

CCTGCAAAACACTGAATAGCTTAAATCTGGACTGGAAAACCTTGGACCACTCTGGGCTGGTGGTGCTCTGTGAGGCTTTGAATCACAAAAGATGTAACCT

GAAGATGCTTGG CAGTGGAGAGTTAATGTTTCTCATGAAGTGGAAGGACTCAGATGAGGCTGACTTGGTACAGGCAAAGGAGGCAAATATGATATGTCC

TCAGATTGTAATTTCCTTCTATGGGGAGAGGCTGACTTGGCATTCTTGA
Translation
 - UNI35727 - MAGSSGYGLLKLLQKLSDEEFQRFKELLREEPEKFKLKPISWTKIENSSKESLVTLLNTHYPGQAWNMMLSLFLQVNREDLSIMAQ

KKKRH HKQTKYKKFMKTTFERIWTLETNTHIPDRNYHLIVEVQYKALQEIFDSESEPVTAIVAGTTGEGKTTFLRKAMLDWASGVLLQNRFQ QNTAEY

WKTLCGIFCNLYVLDLDSCQFNKRAIQDLCNSMSPTPTVPLTAFKLQSLS SCSFMADFGDGSLFHTLLQLPHLKYLNLYGTYLSMDVTEKLCAALRCSA

CRVEELL LLGKCGISSKACGIIAISLINSKVKHLSLVENPLKNKGVMSLCEMLKDPSCVLQSLM MLSYCCLTFIACGHLYEALLSNKHLSLLDLGSNF

LEDTGVNLLCEALKDPNCTLKELW WLDLCEFTSDCCKDLALALTTCKTLNSLNLDWKTLDHSGLVVLCEALNHKRCNLKMLG GSGELMFLMKWKDSDE

ADLVQAKEANMICPQIVISFYGERLTWHS

For any suggestions or comments, please send an email to unitrap@crg.es