Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000060601 (Nr1h2)
Chromosomal location
Chr 7: 51804986 - 51809318 (-)
Description
nuclear receptor subfamily 1, group H, member 2 Gene [Source:MGI (curated);Acc:Nr1h2-001]
RefSeq_dna
NM_009473 
RefSeq_peptide
NP_033499.1 
UniGene
Mm.968 
MGI
MGI:1352463 
Uniprot/SWISSPROT
Q60644 
Uniprot/SPTREMBL
Q8BP65 
Human Ortholog
ENSG00000131408 (NR1H2)
Omim not available
UniTrap UNI38653
Vector Insertion
Chr 7: 51808948 - 51809294
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26621
Vector Insertion
Chr 7: 51805502 - 51805669
Public Clones not available
Private Clones OST107088 (lexicon)
Severity of mutation (?) Insertion after 89% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000107910
Sequence
GGCGAAGTTACTTTTGCTTTTCGCTCAGCAAGCGCTGTTGCTTCGAGCTACTCCCAGGCTTCTGAAGTTACTTCCAAAGTGCTGTGGAGGCACAATCACC

GGTGCGGACACAGAG CTCTCGCCTCCCACGGCCGTTTCCAGGGCAACAGAGTCGGAGACCCCCTGCGACCCCCCTCCCGATCGCCGGTGCAGTCATGAG

CCCCGCCTCCCCCTGGTGCACGGAGAGGGGCGGGGCCTGGAACAAG CAGGCTGCTTCGTGACCCACTATGTCTTCCCCCACAAGTTCTCTGGACACTCC

CGTGCCTG GGAATGGTTCTCCTCAGCCCAGTACCTCCGCCACGTCACCCACTATTAAGGAAGAGGGGCAGGAGACTGATCCTCCTCCAGGCTCTGAAGG

GTCCAGCTCTGCCTACATCGTGG AGCCAGAGGATGAGCCTGAGCGCAAGCGGAAGAAGGGGCCGGCCCCGAAGATGCTGGGCCATGAGCTGTGCCGCGT

GTGCGGAGACAAGGCTTCGGGCTTCCACTACAACGTGCTCAGCTGTGAAGGCTGCAAAGGCTTCTTCCGGCGCAGTGTGGTCCACGGTGGGGCCGGGCGC

TATGCCTGTCGGGGCAGCGGAACCTGCCAGATGGATGCCTTCATGCGGCGCAAGTGCCAGCTCTGCCGGCTGCGCAAGTGCAAGGAGGCTGGCATGCGGG

AGCAGT GCGTGCTCTCTGAGGAGCAGATTCGGAAGAAAAGGATTCAGAAGCAGCAACAGCAGCAGCCACCACCCCCATCTGAGCCAGCAGCCAGCAGCT

CAGGCCGGCCAGCGGCCTCCCCTGGCACTTCGGAAGCAAGCAGCCAGGGCTCCGGGGAAGGAGAGGGCATCCAGCTGACCGCGGCTCAGGAGCTGATGAT

CCAGCAGTTAGTTGCCGCGCAGCTGCAGTGCAACAAACGATCTTTCTCCGACCAGCCCAAAGTCACG CCCTGGCCCCTGGGTGCAGACCCTCAGTCCCG

AGATGCCCGTCAGCAACGCTTTGCCCACTTCACCGAGCTAGCCATCATCTCGGTCCAGGAGATTGTGGACTTTGCCAAGCAGGTGCCAGGGTTCTTGCAG

TTGGGCCGGGAGGACCAGATCGCCCTCCTGAAGGCGTCCACCATTGAG ATCATGTTGCTAGAAACAGCCAGACGCTACAACCACGAGACAGAATGCATC

ACGTTCCTGAAGGACTTCACCTACAGCAAGGACGACTTCCACCGTGCAG GCTTGCAGGTGGAATTCATCAATCCCATCTTCGAGTTCTCGCGGGCCATG

CGGCGGCTGGGCCTGGACGATGCAGAGTATGCCTTGCTTATCGCCATCAACATCTTCTCAGCCGATCGGCCTAATGTGCAGGAGCCCAGCCGTGTGGAGG

CCCTGCAGCAGCCCTACGTGGAGGCGCTCCTCTCCTACACGAGGATCAAGCGCCCACAG - UNI26621 - GACCAGCTCCGCTTCCCACGCATGCTC

ATGAAGCTGGTGAGCCTGCGCACCCTCAGCTCCGTGCACTCGGAGCAGGTCTTTGCATTGCGACTCCAGGACAAGAAGCTGCCGCCCTTGCTGTCCGAGA

TCTGGGATGTGCACGAGTAGGGGCAGCCACAAGTGCCCCAGCCTTGGTGGTGTCTTCTTGAAGATGGACTCTTCACCTCTCCTCCTGGGGTGGGAGGACA

TTGTCACGGCCCAGTCCCTCGGGCTCAGCCTCAAACTCAGCGGCAGTTGGCACTAGAAGGCCCCACCCCACCCATTGAGTCTTCCAAGAGTGGTGAGGGT

CACAGGTCCTAGCCTCTGACCGTTCCCAGCTGCCCTCCCACCCACGCTTACACCTCAGCCTACCACACCATGCACCTTGAGTGGAGAGAGGTTAGGGCAG

GTGGCCCCCCACAGTTGGGAGACCACAGGCCCTCTCTTCTGCCCCTTTTATTTAATAAAAAAACAAAAAT
Translation
  MSSPTSSLDTPVPG GNGSPQPSTSATSPTIKEEGQETDPPPGSEGSSSAYIVE EPEDEPERKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEG

CKGFFRRSVVHGGAGRYACRGSGTCQMDAFMRRKCQLCRLRKCKEAGMREQC CVLSEEQIRKKRIQKQQQQQPPPPSEPAASSSGRPAASPGTSEASSQ

GSGEGEGIQLTAAQELMIQQLVAAQLQCNKRSFSDQPKVT PWPLGADPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQIALLKASTI

E IMLLETARRYNHETECITFLKDFTYSKDDFHRAG GLQVEFINPIFEFSRAMRRLGLDDAEYALLIAINIFSADRPNVQEPSRVEALQQPYVEALLSY

TRIKRPQ - UNI26621 - DQLRFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHE
Transcript ENSMUST00000107911
Sequence
GCGCAGCGGGGTTGCCGGAAGAAGTGGCGAAGTTACTTTTGCTTTTCGCTCAGCAAGCGCTGTTGCTTCGAGCTACTCCCAGGCTTCTGAAGTTACTTCC

AAAGTGCTGTGGAGGCACAATCACCGGTGCGGACACAGAG CTCTCGCCTCCCACGGCCGTTTCCAGGGCAACAGAGTCGGAGACCCCCTGCGACCCCCC

TCCCGATCGCCGGTGCAGTCATGAGCCCCGCCTCCCCCTGGTGCACGGAGAGGGGCGGGGCCTGGAACAAG GCTGCTTCGTGACCCACTATGTCTTCCC

CCACAAGTTCTCTGGACACTCCCGTGCCTG GGAATGGTTCTCCTCAGCCCAGTACCTCCGCCACGTCACCCACTATTAAGGAAGAGGGGCAGGAGACTG

ATCCTCCTCCAGGCTCTGAAGGGTCCAGCTCTGCCTACATCGTGG AGCCAGAGGATGAGCCTGAGCGCAAGCGGAAGAAGGGGCCGGCCCCGAAGATGC

TGGGCCATGAGCTGTGCCGCGTGTGCGGAGACAAGGCTTCGGGCTTCCACTACAACGTGCTCAGCTGTGAAGGCTGCAAAGGCTTCTTCCGGCGCAGTGT

GGTCCACGGTGGGGCCGGGCGCTATGCCTGTCGGGGCAGCGGAACCTGCCAGATGGATGCCTTCATGCGGCGCAAGTGCCAGCTCTGCCGGCTGCGCAAG

TGCAAGGAGGCTGGCATGCGGGAGCAGT GCGTGCTCTCTGAGGAGCAGATTCGGAAGAAAAGGATTCAGAAGCAGCAACAGCAGCAGCCACCACCCCCA

TCTGAGCCAGCAGCCAGCAGCTCAGGCCGGCCAGCGGCCTCCCCTGGCACTTCGGAAGCAAGCAGCCAGGGCTCCGGGGAAGGAGAGGGCATCCAGCTGA

CCGCGGCTCAGGAGCTGATGATCCAGCAGTTAGTTGCCGCGCAGCTGCAGTGCAACAAACGATCTTTCTCCGACCAGCCCAAAGTCACG CCCTGGCCCC

TGGGTGCAGACCCTCAGTCCCGAGATGCCCGTCAGCAACGCTTTGCCCACTTCACCGAGCTAGCCATCATCTCGGTCCAGGAGATTGTGGACTTTGCCAA

GCAGGTGCCAGGGTTCTTGCAGTTGGGCCGGGAGGACCAGATCGCCCTCCTGAAGGCGTCCACCATTGAG ATCATGTTGCTAGAAACAGCCAGACGCTA

CAACCACGAGACAGAATGCATCACGTTCCTGAAGGACTTCACCTACAGCAAGGACGACTTCCACCGTGCAG GCTTGCAGGTGGAATTCATCAATCCCAT

CTTCGAGTTCTCGCGGGCCATGCGGCGGCTGGGCCTGGACGATGCAGAGTATGCCTTGCTTATCGCCATCAACATCTTCTCAGCCGATCGGCCTAATGTG

CAGGAGCCCAGCCGTGTGGAGGCCCTGCAGCAGCCCTACGTGGAGGCGCTCCTCTCCTACACGAGGATCAAGCGCCCACAG - UNI26621 - GACCA

GCTCCGCTTCCCACGCATGCTCATGAAGCTGGTGAGCCTGCGCACCCTCAGCTCCGTGCACTCGGAGCAGGTCTTTGCATTGCGACTCCAGGACAAGAAG

CTGCCGCCCTTGCTGTCCGAGATCTGGGATGTGCACGAGTAGGGGCAGCCACAAGTGCCCCAGCCTTGGTGGTGTCTTCTTGAAGATGGACTCTTCACCT

CTCCTCCTGGGGTGGGAGGACATTGTCACGGCCCAGTCCCTCGGGCTCAGCCTCAAACTCAGCGGCAGTTGGCACTAGAAGGCCCCACCCCACCCATTGA

GTCTTCCAAGAGTGGTGAGGGTCACAGGTCCTAGCCTCTGACCGTTCCCAGCTGCCCTCCCACCCACGCTTACACCTCAGCCTACCACACCATGCACCTT

GAGTGGAGAGAGGTTAGGGCAGGTGGCCCCCCACAGTTGGGAGACCACAGGCCCTCTCTTCTGCCCCTTTTATTTAATAAAAAAACAAAAATAAAGTTTG

AGTACAAGCC
Translation
  MSSPTSSLDTPVPG GNGSPQPSTSATSPTIKEEGQETDPPPGSEGSSSAYIVE EPEDEPERKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEG

CKGFFRRSVVHGGAGRYACRGSGTCQMDAFMRRKCQLCRLRKCKEAGMREQC CVLSEEQIRKKRIQKQQQQQPPPPSEPAASSSGRPAASPGTSEASSQ

GSGEGEGIQLTAAQELMIQQLVAAQLQCNKRSFSDQPKVT PWPLGADPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQIALLKASTI

E IMLLETARRYNHETECITFLKDFTYSKDDFHRAG GLQVEFINPIFEFSRAMRRLGLDDAEYALLIAINIFSADRPNVQEPSRVEALQQPYVEALLSY

TRIKRPQ - UNI26621 - DQLRFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHE
Transcript ENSMUST00000107912
Sequence
CCAGGGCAACAGAGTCGGAGACCCCCTGCGACCCCCCTCCCGATCGCCGGTGCAGTCATGAGCCCCGCCTCCCCCTGGTGCACGGAGAGGGGCGGGGCCT

GGAACAAG CAGGCTGCTTCGTGACCCACTATGTCTTCCCCCACAAGTTCTCTGGACACTCCCGTGCCTG GGAATGGTTCTCCTCAGCCCAGTACCTCC

GCCACGTCACCCACTATTAAGGAAGAGGGGCAGGAGACTGATCCTCCTCCAGGCTCTGAAGGGTCCAGCTCTGCCTACATCGTGG TCATCTTAGAGCCA

GAGGATGAGCCTGAGCGCAAGCGGAAGAAGGGGCCGGCCCCGAAGATGCTGGGCCATGAGCTGTGCCGCGTGTGCGGAGACAAGGCTTCGGGCTTCCACT

ACAACGTGCTCAGCTGTGAAGGCTGCAAAGGCTTCTTCCGGCGCAGTGTGGTCCACGGTGGGGCCGGGCGCTATGCCTGTCGGGGCAGCGGAACCTGCCA

GATGGATGCCTTCATGCGGCGCAAGTGCCAGCTCTGCCGGCTGCGCAAGTGCAAGGAGGCTGGCATGCGGGAGCAGT GCGTGCTCTCTGAGGAGCAGAT

TCGGAAGAAAAGGATTCAGAAGCAGCAACAGCAGCAGCCACCACCCCCATCTGAGCCAGCAGCCAGCAGCTCAGGCCGGCCAGCGGCCTCCCCTGGCACT

TCGGAAGCAAGCAGCCAGGGCTCCGGGGAAGGAGAGGGCATCCAGCTGACCGCGGCTCAGGAGCTGATGATCCAGCAGTTAGTTGCCGCGCAGCTGCAGT

GCAACAAACGATCTTTCTCCGACCAGCCCAAAGTCACG CCCTGGCCCCTGGGTGCAGACCCTCAGTCCCGAGATGCCCGTCAGCAACGCTTTGCCCACT

TCACCGAGCTAGCCATCATCTCGGTCCAGGAGATTGTGGACTTTGCCAAGCAGGTGCCAGGGTTCTTGCAGTTGGGCCGGGAGGACCAGATCGCCCTCCT

GAAGGCGTCCACCATTGAG ATCATGTTGCTAGAAACAGCCAGACGCTACAACCACGAGACAGAATGCATCACGTTCCTGAAGGACTTCACCTACAGCAA

GGACGACTTCCACCGTGCAG GCTTGCAGGTGGAATTCATCAATCCCATCTTCGAGTTCTCGCGGGCCATGCGGCGGCTGGGCCTGGACGATGCAGAGTA

TGCCTTGCTTATCGCCATCAACATCTTCTCAGCCGATCGGCCTAATGTGCAGGAGCCCAGCCGTGTGGAGGCCCTGCAGCAGCCCTACGTGGAGGCGCTC

CTCTCCTACACGAGGATCAAGCGCCCACAG - UNI26621 - GACCAGCTCCGCTTCCCACGCATGCTCATGAAGCTGGTGAGCCTGCGCACCCTCAG

CTCCGTGCACTCGGAGCAGGTCTTTGCATTGCGACTCCAGGACAAGAAGCTGCCGCCCTTGCTGTCCGAGATCTGGGATGTGCACGAGTAGGGGCAGCCA

CAAGTGCCCCAGCCTTGGTGGTGTCTTCTTGAAGATGGACTCTTCACCTCTCCTCCTGGGGTGGGAGGACATTGTCACGGCCCAGTCCCTCGGGCTCAGC

CTCAAACTCAGCGGCAGTTGGCACTAGAAGGCCCCACCCCACCCATTGAGTCTTCCAAGAGTGGTGAGGGTCACAGGTCCTAGCCTCTGACCGTTCCCAG

CTGCCCTCCCACCCACGCTTACACCTCAGCCTACCACACCATGCACCTTGAGTGGAGAGAGGTTAGGGCAGGTGGCCCCCCACAGTTGGGAGACCACAGG

CCCTCTCTTCTGCCCCTTTTATTTAATAAAAAAACAAAAATAAAGTTTGAGTACAAGCCA
Translation
 MSSPTSSLDTPVPG GNGSPQPSTSATSPTIKEEGQETDPPPGSEGSSSAYIVV VILEPEDEPERKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSC

EGCKGFFRRSVVHGGAGRYACRGSGTCQMDAFMRRKCQLCRLRKCKEAGMREQC CVLSEEQIRKKRIQKQQQQQPPPPSEPAASSSGRPAASPGTSEAS

SQGSGEGEGIQLTAAQELMIQQLVAAQLQCNKRSFSDQPKVT PWPLGADPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQIALLKAS

TIE IMLLETARRYNHETECITFLKDFTYSKDDFHRAG GLQVEFINPIFEFSRAMRRLGLDDAEYALLIAINIFSADRPNVQEPSRVEALQQPYVEALL

SYTRIKRPQ - UNI26621 - DQLRFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHE
Transcript ENSMUST00000073488
Sequence
GCGCAGCGGGGTTGCCGGAAGAAGTGGCGAAGTTACTTTTGCTTTTCGCTCAGCAAGCGCTGTTGCTTCGAGCTACTCCCAGGCTTCTGAAGTTACTTCC

AAAGTGCTGTGGAGGCACAATCACCGGTGCGGACACAGAG CTCTCGCCTCCCACGGCCGTTTCCAGGGCAACAGAGTCGGAGACCCCCTGCGACCCCCC

TCCCGATCGCCGGTGCAGTCATGAGCCCCGCCTCCCCCTGGTGCACGGAGAGGGGCGGGGCCTGGAACAAG GCTGCTTCGTGACCCACTATGTCTTCCC

CCACAAGTTCTCTGGACACTCCCGTGCCTG GGAATGGTTCTCCTCAGCCCAGTACCTCCGCCACGTCACCCACTATTAAGGAAGAGGGGCAGGAGACTG

ATCCTCCTCCAGGCTCTGAAGGGTCCAGCTCTGCCTACATCGTGG TCATCTTAGAGCCAGAGGATGAGCCTGAGCGCAAGCGGAAGAAGGGGCCGGCCC

CGAAGATGCTGGGCCATGAGCTGTGCCGCGTGTGCGGAGACAAGGCTTCGGGCTTCCACTACAACGTGCTCAGCTGTGAAGGCTGCAAAGGCTTCTTCCG

GCGCAGTGTGGTCCACGGTGGGGCCGGGCGCTATGCCTGTCGGGGCAGCGGAACCTGCCAGATGGATGCCTTCATGCGGCGCAAGTGCCAGCTCTGCCGG

CTGCGCAAGTGCAAGGAGGCTGGCATGCGGGAGCAGT GCGTGCTCTCTGAGGAGCAGATTCGGAAGAAAAGGATTCAGAAGCAGCAACAGCAGCAGCCA

CCACCCCCATCTGAGCCAGCAGCCAGCAGCTCAGGCCGGCCAGCGGCCTCCCCTGGCACTTCGGAAGCAAGCAGCCAGGGCTCCGGGGAAGGAGAGGGCA

TCCAGCTGACCGCGGCTCAGGAGCTGATGATCCAGCAGTTAGTTGCCGCGCAGCTGCAGTGCAACAAACGATCTTTCTCCGACCAGCCCAAAGTCACG C

CCTGGCCCCTGGGTGCAGACCCTCAGTCCCGAGATGCCCGTCAGCAACGCTTTGCCCACTTCACCGAGCTAGCCATCATCTCGGTCCAGGAGATTGTGGA

CTTTGCCAAGCAGGTGCCAGGGTTCTTGCAGTTGGGCCGGGAGGACCAGATCGCCCTCCTGAAGGCGTCCACCATTGAG ATCATGTTGCTAGAAACAGC

CAGACGCTACAACCACGAGACAGAATGCATCACGTTCCTGAAGGACTTCACCTACAGCAAGGACGACTTCCACCGTGCAG GCTTGCAGGTGGAATTCAT

CAATCCCATCTTCGAGTTCTCGCGGGCCATGCGGCGGCTGGGCCTGGACGATGCAGAGTATGCCTTGCTTATCGCCATCAACATCTTCTCAGCCGATCGG

CCTAATGTGCAGGAGCCCAGCCGTGTGGAGGCCCTGCAGCAGCCCTACGTGGAGGCGCTCCTCTCCTACACGAGGATCAAGCGCCCACAG - UNI2662

1 - GACCAGCTCCGCTTCCCACGCATGCTCATGAAGCTGGTGAGCCTGCGCACCCTCAGCTCCGTGCACTCGGAGCAGGTCTTTGCATTGCGACTCCAG

GACAAGAAGCTGCCGCCCTTGCTGTCCGAGATCTGGGATGTGCACGAGTAGGGGCAGCCACAAGTGCCCCAGCCTTGGTGGTGTCTTCTTGAAGATGGAC

TCTTCACCTCTCCTCCTGGGGTGGGAGGACATTGTCACGGCCCAGTCCCTCGGGCTCAGCCTCAAACTCAGCGGCAGTTGGCACTAGAAGGCCCCACCCC

ACCCATTGAGTCTTCCAAGAGTGGTGAGGGTCACAGGTCCTAGCCTCTGACCGTTCCCAGCTGCCCTCCCACCCACGCTTACACCTCAGCCTACCACACC

ATGCACCTTGAGTGGAGAGAGGTTAGGGCAGGTGGCCCCCCACAGTTGGGAGACCACAGGCCCTCTCTTCTGCCCCTTTTATTTAATAAAAAAACAAAAA

TAAAGTTTGAGTACAAGCC
Translation
  MSSPTSSLDTPVPG GNGSPQPSTSATSPTIKEEGQETDPPPGSEGSSSAYIVV VILEPEDEPERKRKKGPAPKMLGHELCRVCGDKASGFHYNVLS

CEGCKGFFRRSVVHGGAGRYACRGSGTCQMDAFMRRKCQLCRLRKCKEAGMREQC CVLSEEQIRKKRIQKQQQQQPPPPSEPAASSSGRPAASPGTSEA

SSQGSGEGEGIQLTAAQELMIQQLVAAQLQCNKRSFSDQPKVT PWPLGADPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQIALLKA

STIE IMLLETARRYNHETECITFLKDFTYSKDDFHRAG GLQVEFINPIFEFSRAMRRLGLDDAEYALLIAINIFSADRPNVQEPSRVEALQQPYVEAL

LSYTRIKRPQ - UNI26621 - DQLRFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHE

For any suggestions or comments, please send an email to unitrap@crg.es