Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000060657 (4921513D23Rik)
Chromosomal location
Chr 16: 14110626 - 14159367 (-)
Description
RIKEN cDNA 4921513D23 gene Gene [Source:MGI Symbol;Acc:MGI:2444505]
RefSeq_dna
NM_001081154 
RefSeq_peptide
NP_001074623.1 
UniGene
Mm.379361 
MGI
MGI:2444505 
Uniprot/SWISSPROT
Q8BJ34 
Uniprot/SPTREMBL
Q6IS63 
Human Ortholog
ENSG00000166783 (KIAA0430)
Omim not available
UniTrap UNI4745
Vector Insertion
Chr 16: 14154125 - 14159236
Public Clones CB0301 (sanger) D183G07 (ggtc) IST14997A5 (tigm)
Private Clones OST295423 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI3937
Vector Insertion
Chr 16: 14151410 - 14152050
Public Clones AS0671 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35265
Vector Insertion
Chr 16: 14128603 - 14128987
Public Clones IST10126D4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 68% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI346
Vector Insertion
Chr 16: 14115935 - 14116082
Public Clones GC0934 (tigem)
Private Clones not available
Severity of mutation (?) Insertion after 89% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000078747
Sequence
ATGGAGAACAAGAAAGCTGCTGTGGAGTTAAAGGATATACCATCTCCCCTTCATGTTGGCTCTAAATTTTTCCCAGCAGTCCCACTTCCTGATATTCGTT

CTCTTCAGCAACCTAAAGTACAGCTCTCAGCTATTCCCAAAGTAAGCTGCTGTGCTCATTGCCCTAATGAACCCTCCACTTCACCCATGCGTTTTGGTGG

TGGCAGTGGCAGTAGTGGAGGTTCTGGGAGCTTGATTCACACGGGCTCACTCTTAGACTCACCAAGCACTGGGACAGTCACGTGTCAAGTAGGGTCAGGT

TTTGCTTTCCAGTCCGTGTCTTCACTGCAGAATGCCTCCACTAGGAACAACTTGGTGGGCCTTTCAAGTGACTTCCCCAGCATGTGTGTAGAGAGTAACC

TACCTTCCTGCAAGCACCTGTCGTGTTGTGGGAAGCTCCATTTCCAGTCATGTCACAGTAATGTACACAAGCTGCATCAGTTCCAGAATCTTCAGGGCTG

TGCCTCTGCTGGCTATTTCCCCTGTTCCGATTTCCCAAGTGGGGCTCCTGGGCATTTGGAAGAGCGCCTTTCCCATTCAGAGCTTACACCTCACTTGTGC

ACCAACTCTCTTCACCTAAATGTGGCACCTCCGGTTTGTTTAAAGGGCTCACTTTACTGTGAAGACTGTCTAAACAAGGTCTGTATCTTTTATTCTTTAT

CTTGGGGGAGAAGAGGTTTGGTTCTGTTAAATGGCTCTATCTGGCC - UNI3937 - TATACCACCTCCAAGTACTCAGCCTGCACCTCCAGCTATTC

CTGTGTGTAATGGCTGTGGAACAAAAGGCATGGAAAAGGAGACCTCATTGTTGTTGGCAACCAGTCTAGGCAAAACTGCTTCGAAATTTG GGTCACCAG

AAGTTGCAGTCACTGGACAGGTGCTGGAGACCCTCCCCCCCATTGGCGTTTTCTGGGATATTGAAAACTGCTCAGTCCCCTCTGGCCGGTCAGCAACAAC

TGTTGTACAGAGAATCCGTGAGAAGTTTTTTAGAGGACACAGAGAAGCAGAGTTTATCTGTGTGTGTGACATCAGTAAAGAAAACAAGGAAGTTATTCAA

GAGCTGAATAATT CAGCTGATGTCAATTTTGCGTTGGAACTCAGTGATCTTAGGCACCGGCACGGTTTCCACATCATTTTGGTACATAAAAACCAGGCC

TCTGAAGCCTTGTTACATCATGCTAACCAGCTGATCAGATTTGAAGAGTTCATTTCTGATCTCCCCCCTCGGTTACCACTGAAGATTCCT TGCCACACT

CTACTCTATGTTTATAACCTGCCAGCAAATAAAGATGGCAAGAGCATCAGCAACAGGCTCAGGCGCCTCTCTGATAACTGTGGTGGCAAGGTGCTGAGTA

TCACAGGCTGCAGCGCAATTCTCCGCTTCATAAACCAGGACAGTGCAGAGCGGGCCCAGAAGCGAATGGAAAATGAAGATGTCTTTGGCAACAGGATCAT

CGTGTCCTTTACTCCAAAACATAGAGAATTCTTTGAAGCCAAGAGTTCAAATGCTATTGCCGACAAAGTGAAGTCTCCCAAAAAAGTTAAGAACACAAAA

TTGTGCCTCATCAAAGACACAAGTGAACAGTCACCCAGTGTCAAAGCCATGCCAGGGAAAGTGTTGCAGGCAAATTCTGGATCTGCTACAAAAACCACAA

ACATTAAAAGTTTACAG GAGCTGTGCCGAATGGAGTCAAAGTCTGGCAATAGAAACAGTGACCATCAGCAAGGCCATGGGAGGCTGGCAGCACTGCCTA

ACAGTGGTCCAACTGCTTCAGTGCCCATCGTGAAGAACACAGGTGTGACAGAGCCACTTTACAGAAGCAGTCAGAA AAAAGAGAACCCCAGTTCCCAGA

GCACTGTCAACTCTCCTGTAGAGAAGAAGAAGAGAGAGGAGACTGTCTTCCAAGTAAGCTACCCATCCGCATTCAGCAAGCTGATCGCCTCAAGGCAAGT

CAGCCCTCTGCTCACCTCTCAGTCTTGGTCTCCGAG AGCCTCACCACTTGCTTTCAACATTGCCAATCCCAGCAGCGGTGCTGACTGCCCAGACCCATT

TGCAAATGGTGTTGACATCCAGGTCAGCAATGTGGACTACAGGCTGTCCCGGAAGGAGCTGCAGCAGCTCCTCCAGGAAGCCTTTTCCAAGCATGGCCAG

 GTGAAGAGTGTTGAGCTCAGTCCCCATACTGATTACCAGCTCAAGGCCATTGTGCAGATGAGAAACCTGCACGAAGCAATCTGTGCAGTGAACAGCCTC

CATAGGCACAAAATTGGCAGCAAGAAGATACTGGTCTCACTCTCCACAGGAGCTGCCAACAAGTCACTCTCTTTACTAAG CACAGAAACAATGTCTATT

CTTCAGGATGCTCCTGCCTGTTGCTTGCCTCTCTTTAAATTTATAGACATCTATGAAAAGAA GTATGGACACAAGTTAAATGTGTCTGATTTATATAAA

TTAACAGACACTATTGCAATCCGTGAACAGGGAAACGGGCGATTGGTGTGTCTCTTACCTAGTAATCAGGCCCGCCAGAGCCCCCTGGGCTCTTCCCAGT

CACATGATGGCTCCTCCTCAAACTGCAGCCCAGTTCTGTTTGAAGAGTTGGAGTATCACGAACCTGTCTGCAAGCAGCACTGCTCTAACAAGGACTTCAG

 TGAACTTGTGTTTGATCCAGACTCTTACAAGATTCCTTTTGTGGTTCTCTCTTTGAAAGTGTTCGCACCTCAAGTTCATAGTCTTCTGCAGACCCACCA

GGGCACTGTGCCTTTGCTAAG CTTTCCAGATTGCTATGCTGCGGAGTTTGGTGACCTAGAAATTACGCAAGACAGCCACAAGGGTGTCCCCTTAGAGCA

CTTCATCACCTGCATTCCAGGAGTGAACATTGCCACTGCTCAGAATGGCGTCAAAGTAGTGAAGTGGATTCACAACAAGCCCCCACCTCCCAACACTG A

CCCTTGGCTTCTTCGTTCTAAAAGTCCTGTGAGAAATCCCCAGCTGATTCAGTTCAGCAGAGAGGTCATTGATTTACTGAAGACCCAGCCATCGTGTATA

CTACCCGTCAGCAATTTCATCCCTTCATACCATCACCACTTTGGAAAGCAGTGCAGGGTTTCAGACTATGGTTATTCCAAGCTGATTGAACTCCTAGAAG

CTGTGCCTCATGTGTTGCAG - UNI35265 - ATTCTTGGTATGGGCTCCAAGCGTCTGATGACCCTTACTCACAGGGCCCAGGTGAAGCGCTTTACT

CAGGATTTACTAAAACTTCTTAAGTCCCAGGCCAGCAAGCAGGTCATCGTGAGAGACTTTTCACAGGCTTATCATTG - UNI35265 - GTGTTTCTC

AAAGGACTGGGATGTCACGGAATATGGTGTTTGTGACTTGATTGATATAATATCAGAGATCCCAGACACAACTATTTGCTTGTCCCAACAAGATGACGAC

ATGGTCATTTGTATCCGAAAAAGAG - UNI35265 - AACGAACTCAGGATGAAATAGAAAGGACAAAGCAGTTCTCCAAAGATGTTGTGGACTTGCT

GCGCCACCAGCCCCATTTCAGAATGCCCTTCAACAAGTTCATTCCCTCTTACCACCACCACTTTGGCCGACAGTGTAAACTTGCATACTATGGATTTACC

AAGCTGCTTGAACTTTTGGAAGCCATACCTGAGATTTTACAA GTGTTGGAATGTGGAGAAGAAAAAATCCTGACTTTGACTGAAGTGGAGCGATTCAAA

GCTCTAGCCGCCCAGTTTGTTAAGCTTCTGCGGTCCCAAAAGGGTAACTGCCTTATGATGACAGATCTGTTTACAGAATATGCTAAAACTTTTGGTTATA

CATTTCGTCTCCAAGACTATGATGTCAGTTCAGTCTCAGCTTTGACACAGAAGCTCTGCCATGTTGTAAAG GTTGCTGATATGGAGTCTGGTAAACAGA

TCCAGCTGATCAATAGGAAGTCTCTGCGGTCTCTCACTGCTCAGTTGCTGGTCTTGTTGATGTCTTGGGAAGGGGATGCTTATCTTCCTGTTGATGAGCT

CAGGAGACATTATGAAACCACTCACAGCACTCCTCTCAACCCCTGTGAATATGGATTCATGACCCTGACTGAGCTACTGAAGAGTCTGCCGTACTTAGTA

GAG GTTTGTACGAACGATAAGGCAGAAGAGTATGTGAAGCTCACAAGCCTGTACTTGTTTGCAAAGAATGTGAGGTCTTTGCTTCATACCTATCACTAC

CAGCAGATTTTTCTTCATGAATTTTCCATGGCCTATAACAAATATGTTGGAGAAACACTACAGCCCAAAACTTATGGCTACAGTAGTGTGGAGGAATTAC

TGGGAGCCATCCCACAG GTGGTCTGGATAAAAGGACATGGTCATAAGAGAATTGTAGTGTTAAAAAATGACATGAAAA - UNI346 - ACCGCCTAA

GCTCATTTGACCTTTTCTCTGTCAATCATGAAGACCAGCCTGCAGTGAGCAGGCAGATCCTGGCGGTGCCAGAATCCCATCTAGCCTCAGAACTCCAGCT

CCGAACAGGTACTG GACCCAGCCAGATGGAGCAGGAGCTTCTGCACCTGGCCAGCAGCTCCCCCGTTGACCTGCTCTGTGCTCCTGTTCCTTCATGCCT

GCCATCCCCTCAGCTAAGACCAGATCCTGTCATCCTGAAGCCCGCTGATCTCATTCAGTTTGAGGAACACCCTCAAGAGCCTTTGG GAGTTTTAGTTTT

AAACCAAGAAGAAAAATCAGAAGTTCCACTACCAGTGCAAAAGGGAAACCTGTCCTGTGACTCCTCACCCAGCAGCCCAGCAGCTTCTCCTGCTCCTCCT

GGCCCCTCCTCAGAAGCCCCCAGGCCACTTTTCAGCAAGGATGCAGTGGAAAGCCCAGCCAAAAAGCAGCCCAAAAATAGAGTCAAATTGGCAGCCAACT

TTTCTTTTGCACCTGTAACCAAGCTTTAACTCCCATTTGAACATGGAATTAAATTAGGATGGGGGAAAACTGTCTGACTCTACACACAAAAATGGGCTTA

AAAACCTCATTTTATATCTTGACCCCAGAAGCCACTTTCATTAATGGCACCTAGGGAAATGGTTGGGTTTTTGTTGTTGTTGTTGTTTTTTGTTTGTTTG

TTTTTGTTTTTGTTTTATTTTTAAACTTTTAGATAAACATGTTCTTCCTTTATTTCTCCCACTTATTTGAAAGAACTCTTCCATTAAGGAATCTGTAATA

TTTCACCAAATTTTTCTAGACTGTTGTGAATTGTGGTGGTTGGGAAGAAATTCGCAGAGATCACTCAGCAGGAAGTGGCTTGAGTCCCATTGAGCAATCT

CCATCATTTGTTTAAGCAAATGGATTTGTGGTTGTTCGAGAAGCCAAGCATGCCCATGAGCCTGTGGGTCACACACTGGGGAATGAGTGAGTGGCAGGAG

AGCCATTTTTAGGCTGACAGGAAAGTTCCTGGCTTCTAGGTGACTTGTTGGTGTGCCTTGTTTTTTATGTAACTATGTCTGGTTAACCAGTGTAGCTTCA

TCCCATTTTTTTAAACATTTGCATTTGGGGATTCCATTTAAGAGCTTTCTAGAAAGTTATTTCATGCTTCCCTTCTCTGTCTGTCCCAGTTTGATAAGGA

TAAGGTTAAGGAGAGGAGATGGCCTCGATGTCATGTATTTAAAGTCAGGGTTTAAATGACACATTGTGTGTTGAGAGGTGGCAATGGTAAGAGTCTGATT

TTTTTAAACTATGCATTAAATGTATAAATTGTAAATCAGCTGAAGTGCTTCAAGAGGCGTGGGTTAGATACTATTGCCACTAAGAAGAGACCAGAGTTCT

ATCTGTAATGTGAAGGCCAAGTTTGATCAGCCTATCCTTGTTCTTGCGATTTAAAAGTTGGCTGTAAATCTGGGAAGCTCTCCATGTGAAGATGTGTGTC

CATGTTAGTTCATCTGGACGTCTCTC
Translation
MENKKAAVELKDIPSPLHVGSKFFPAVPLPDIRSLQQPKVQLSAIPKVSCCAHCPNEPSTSPMRFGGGSGSSGGSGSLIHTGSLLDSPSTGTVTCQVGSG

FAFQSVSSLQNASTRNNLVGLSSDFPSMCVESNLPSCKHLSCCGKLHFQSCHSNVHKLHQFQNLQGCASAGYFPCSDFPSGAPGHLEERLSHSELTPHLC

TNSLHLNVAPPVCLKGSLYCEDCLNKVCIFYSLSWGRRGLVLLNGSIWP - UNI3937 - PIPPPSTQPAPPAIPVCNGCGTKGMEKETSLLLATSLG

KTASKFG GSPEVAVTGQVLETLPPIGVFWDIENCSVPSGRSATTVVQRIREKFFRGHREAEFICVCDISKENKEVIQELNNS SADVNFALELSDLRHR

HGFHIILVHKNQASEALLHHANQLIRFEEFISDLPPRLPLKIP CHTLLYVYNLPANKDGKSISNRLRRLSDNCGGKVLSITGCSAILRFINQDSAERAQ

KRMENEDVFGNRIIVSFTPKHREFFEAKSSNAIADKVKSPKKVKNTKLCLIKDTSEQSPSVKAMPGKVLQANSGSATKTTNIKSLQ ELCRMESKSGNRN

SDHQQGHGRLAALPNSGPTASVPIVKNTGVTEPLYRSSQK KKENPSSQSTVNSPVEKKKREETVFQVSYPSAFSKLIASRQVSPLLTSQSWSPR RASP

LAFNIANPSSGADCPDPFANGVDIQVSNVDYRLSRKELQQLLQEAFSKHGQ VKSVELSPHTDYQLKAIVQMRNLHEAICAVNSLHRHKIGSKKILVSLS

TGAANKSLSLLS STETMSILQDAPACCLPLFKFIDIYEKK KYGHKLNVSDLYKLTDTIAIREQGNGRLVCLLPSNQARQSPLGSSQSHDGSSSNCSPV

LFEELEYHEPVCKQHCSNKDFS SELVFDPDSYKIPFVVLSLKVFAPQVHSLLQTHQGTVPLLS SFPDCYAAEFGDLEITQDSHKGVPLEHFITCIPGV

NIATAQNGVKVVKWIHNKPPPPNTD DPWLLRSKSPVRNPQLIQFSREVIDLLKTQPSCILPVSNFIPSYHHHFGKQCRVSDYGYSKLIELLEAVPHVLQ

 - UNI35265 - ILGMGSKRLMTLTHRAQVKRFTQDLLKLLKSQASKQVIVRDFSQAYHW - UNI35265 - WCFSKDWDVTEYGVCDLIDIISEI

PDTTICLSQQDDDMVICIRKRE - UNI35265 - ERTQDEIERTKQFSKDVVDLLRHQPHFRMPFNKFIPSYHHHFGRQCKLAYYGFTKLLELLEAIP

EILQ VLECGEEKILTLTEVERFKALAAQFVKLLRSQKGNCLMMTDLFTEYAKTFGYTFRLQDYDVSSVSALTQKLCHVVK VADMESGKQIQLINRKSL

RSLTAQLLVLLMSWEGDAYLPVDELRRHYETTHSTPLNPCEYGFMTLTELLKSLPYLVE VCTNDKAEEYVKLTSLYLFAKNVRSLLHTYHYQQIFLHEF

SMAYNKYVGETLQPKTYGYSSVEELLGAIPQ VVWIKGHGHKRIVVLKNDMKN - UNI346 - NRLSSFDLFSVNHEDQPAVSRQILAVPESHLASEL

QLRTGTG GPSQMEQELLHLASSSPVDLLCAPVPSCLPSPQLRPDPVILKPADLIQFEEHPQEPLG GVLVLNQEEKSEVPLPVQKGNLSCDSSPSSPAA

SPAPPGPSSEAPRPLFSKDAVESPAKKQPKNRVKLAANFSFAPVTKL
Transcript ENSMUST00000090300
Sequence
GCGGAAGTGGAGGGAGCGCTTGGCGGCGGCGGCGGGAGCTGCGGAGTCGGGAATCAAAATAAAGGGCCTGGGGGGGGTGGGGGGTAGGCGGCGGTGTCGG

AATGTGAGCCAAGAAGGAGCTAGTGGCTGAG - UNI4745 - GGTGGAAGAAAGAGAAAAGAAAGATGAAAGAATGTTGAACCATATTGTCTGGCTAT

GTGATGGAAGGGAAAGGAACTGAGAACCCTTGCAGCAGAACACTTGGATGGTTTCACCAAGATAATGATGCTAAGCCGTGGCTTTGGAAATTCTCTGGTT

GCTTTTCTCGTCCCGAGCAGACATTGCCTCTTAGTTCCCAAACG AAAGAGTACATGGAGAACAAGAAAGCTGCTGTGGAGTTAAAGGATATACCATCTC

CCCTTCATGTTGGCTCTAAATTTTTCCCAGCAGTCCCACTTCCTGATATTCGTTCTCTTCAGCAACCTAAAGTACAGCTCTCAGCTATTCCCAAAGTAAG

CTGCTGTGCTCATTGCCCTAATGAACCCTCCACTTCACCCATGCGTTTTGGTGGTGGCAGTGGCAGTAGTGGAGGTTCTGGGAGCTTGATTCACACGGGC

TCACTCTTAGACTCACCAAGCACTGGGACAGTCACGTGTCAAGTAGGGTCAGGTTTTGCTTTCCAGTCCGTGTCTTCACTGCAGAATGCCTCCACTAGGA

ACAACTTGGTGGGCCTTTCAAGTGACTTCCCCAGCATGTGTGTAGAGAGTAACCTACCTTCCTGCAAGCACCTGTCGTGTTGTGGGAAGCTCCATTTCCA

GTCATGTCACAGTAATGTACACAAGCTGCATCAGTTCCAGAATCTTCAGGGCTGTGCCTCTGCTGGCTATTTCCCCTGTTCCGATTTCCCAAGTGGGGCT

CCTGGGCATTTGGAAGAGCGCCTTTCCCATTCAGAGCTTACACCTCACTTGTGCACCAACTCTCTTCACCTAAATGTGGCACCTCCGGTTTGTTTAAAGG

GCTCACTTTACTGTGAAGACTGTCTAAACAAG - UNI3937 - CCAGCAAGAAATAGTATAATTGATGCTGCTAAAATCTGGCCAAATATACCACCTC

CAAGTACTCAGCCTGCACCTCCAGCTATTCCTGTGTGTAATGGCTGTGGAACAAAAGGCATGGAAAAGGAGACCTCATTGTTGTTGGCAACCAGTCTAGG

CAAAACTGCTTCGAAATTTG GGTCACCAGAAGTTGCAGTCACTGGACAGGTGCTGGAGACCCTCCCCCCCATTGGCGTTTTCTGGGATATTGAAAACTG

CTCAGTCCCCTCTGGCCGGTCAGCAACAACTGTTGTACAGAGAATCCGTGAGAAGTTTTTTAGAGGACACAGAGAAGCAGAGTTTATCTGTGTGTGTGAC

ATCAGTAAAGAAAACAAGGAAGTTATTCAAGAGCTGAATAATTGTCAG GTAACCGTTGCTCACATAAATGCTACTGCAAAGAATGCTGCTGATGATAAA

CTCCGTCAGAGCCTGCGAAGGTTCGCAAACACGCACACTGCTCCAGCTACTGTGGTTCTTGTGTCAA CTGATGTCAATTTTGCGTTGGAACTCAGTGAT

CTTAGGCACCGGCACGGTTTCCACATCATTTTGGTACATAAAAACCAGGCCTCTGAAGCCTTGTTACATCATGCTAACCAGCTGATCAGATTTGAAGAGT

TCATTTCTGATCTCCCCCCTCGGTTACCACTGAAGATTCCT TGCCACACTCTACTCTATGTTTATAACCTGCCAGCAAATAAAGATGGCAAGAGCATCA

GCAACAGGCTCAGGCGCCTCTCTGATAACTGTGGTGGCAAGGTGCTGAGTATCACAGGCTGCAGCGCAATTCTCCGCTTCATAAACCAGGACAGTGCAGA

GCGGGCCCAGAAGCGAATGGAAAATGAAGATGTCTTTGGCAACAGGATCATCGTGTCCTTTACTCCAAAACATAGAGAATTCTTTGAAGCCAAGAGTTCA

AATGCTATTGCCGACAAAGTGAAGTCTCCCAAAAAAGTTAAGAACACAAAATTGTGCCTCATCAAAGACACAAGTGAACAGTCACCCAGTGTCAAAGCCA

TGCCAGGGAAAGTGTTGCAGGCAAATTCTGGATCTGCTACAAAAACCACAAACATTAAAAGTTTACAG GAGCTGTGCCGAATGGAGTCAAAGTCTGGCA

ATAGAAACAGTGACCATCAGCAAGGCCATGGGAGGCTGGCAGCACTGCCTAACAGTGGTCCAACTGCTTCAGTGCCCATCGTGAAGAACACAGGTGTGAC

AGAGCCACTTTACAGAAGCAGTCAGAA AAAAGAGAACCCCAGTTCCCAGAGCACTGTCAACTCTCCTGTAGAGAAGAAGAAGAGAGAGGAGACTGTCTT

CCAAGTAAGCTACCCATCCGCATTCAGCAAGCTGATCGCCTCAAGGCAAGTCAGCCCTCTGCTCACCTCTCAGTCTTGGTCTCCGAG GAGTATGTCTCC

AAACCTTTTGAATAGAGCCTCACCACTTGCTTTCAACATTGCCAATCCCAGCAGCGGTGCTGACTGCCCAGACCCATTTGCAAATGGTGTTGACATCCAG

GTCAGCAATGTGGACTACAGGCTGTCCCGGAAGGAGCTGCAGCAGCTCCTCCAGGAAGCCTTTTCCAAGCATGGCCAG GTGAAGAGTGTTGAGCTCAGT

CCCCATACTGATTACCAGCTCAAGGCCATTGTGCAGATGAGAAACCTGCACGAAGCAATCTGTGCAGTGAACAGCCTCCATAGGCACAAAATTGGCAGCA

AGAAGATACTGGTCTCACTCTCCACAGGAGCTGCCAACAAGTCACTCTCTTTACTAAG CACAGAAACAATGTCTATTCTTCAGGATGCTCCTGCCTGTT

GCTTGCCTCTCTTTAAATTTATAGACATCTATGAAAAGAA GTATGGACACAAGTTAAATGTGTCTGATTTATATAAATTAACAGACACTATTGCAATCC

GTGAACAGGGAAACGGGCGATTGGTGTGTCTCTTACCTAGTAATCAGGCCCGCCAGAGCCCCCTGGGCTCTTCCCAGTCACATGATGGCTCCTCCTCAAA

CTGCAGCCCAGTTCTGTTTGAAGAGTTGGAGTATCACGAACCTGTCTGCAAGCAGCACTGCTCTAACAAGGACTTCAG TGAACTTGTGTTTGATCCAGA

CTCTTACAAGATTCCTTTTGTGGTTCTCTCTTTGAAAGTGTTCGCACCTCAAGTTCATAGTCTTCTGCAGACCCACCAGGGCACTGTGCCTTTGCTAAG 

CTTTCCAGATTGCTATGCTGCGGAGTTTGGTGACCTAGAAATTACGCAAGACAGCCACAAGGGTGTCCCCTTAGAGCACTTCATCACCTGCATTCCAGGA

GTGAACATTGCCACTGCTCAGAATGGCGTCAAAGTAGTGAAGTGGATTCACAACAAGCCCCCACCTCCCAACACTG ACCCTTGGCTTCTTCGTTCTAAA

AGTCCTGTGAGAAATCCCCAGCTGATTCAGTTCAGCAGAGAGGTCATTGATTTACTGAAGACCCAGCCATCGTGTATACTACCCGTCAGCAATTTCATCC

CTTCATACCATCACCACTTTGGAAAGCAGTGCAGGGTTTCAGACTATGGTTATTCCAAGCTGATTGAACTCCTAGAAGCTGTGCCTCATGTGTTGCAG -

 UNI35265 - ATTCTTGGTATGGGCTCCAAGCGTCTGATGACCCTTACTCACAGGGCCCAGGTGAAGCGCTTTACTCAGGATTTACTAAAACTTCTTA

AGTCCCAGGCCAGCAAGCAGGTCATCGTGAGAGACTTTTCACAGGCTTATCATTG - UNI35265 - GTGTTTCTCAAAGGACTGGGATGTCACGGAA

TATGGTGTTTGTGACTTGATTGATATAATATCAGAGATCCCAGACACAACTATTTGCTTGTCCCAACAAGATGACGACATGGTCATTTGTATCCGAAAAA

GAG - UNI35265 - AACGAACTCAGGATGAAATAGAAAGGACAAAGCAGTTCTCCAAAGATGTTGTGGACTTGCTGCGCCACCAGCCCCATTTCAGA

ATGCCCTTCAACAAGTTCATTCCCTCTTACCACCACCACTTTGGCCGACAGTGTAAACTTGCATACTATGGATTTACCAAGCTGCTTGAACTTTTGGAAG

CCATACCTGAGATTTTACAA GTGTTGGAATGTGGAGAAGAAAAAATCCTGACTTTGACTGAAGTGGAGCGATTCAAAGCTCTAGCCGCCCAGTTTGTTA

AGCTTCTGCGGTCCCAAAAGGGTAACTGCCTTATGATGACAGATCTGTTTACAGAATATGCTAAAACTTTTGGTTATACATTTCGTCTCCAAGACTATGA

TGTCAGTTCAGTCTCAGCTTTGACACAGAAGCTCTGCCATGTTGTAAAG GTTGCTGATATGGAGTCTGGTAAACAGATCCAGCTGATCAATAGGAAGTC

TCTGCGGTCTCTCACTGCTCAGTTGCTGGTCTTGTTGATGTCTTGGGAAGGGGATGCTTATCTTCCTGTTGATGAGCTCAGGAGACATTATGAAACCACT

CACAGCACTCCTCTCAACCCCTGTGAATATGGATTCATGACCCTGACTGAGCTACTGAAGAGTCTGCCGTACTTAGTAGAG GTTTGTACGAACGATAAG

GCAGAAGAGTATGTGAAGCTCACAAGCCTGTACTTGTTTGCAAAGAATGTGAGGTCTTTGCTTCATACCTATCACTACCAGCAGATTTTTCTTCATGAAT

TTTCCATGGCCTATAACAAATATGTTGGAGAAACACTACAGCCCAAAACTTATGGCTACAGTAGTGTGGAGGAATTACTGGGAGCCATCCCACAG GTGG

TCTGGATAAAAGGACATGGTCATAAGAGAATTGTAGTGTTAAAAAATGACATGAAAA - UNI346 - ACCGCCTAAGCTCATTTGACCTTTTCTCTGT

CAATCATGAAGACCAGCCTGCAGTGAGCAGGCAGATCCTGGCGGTGCCAGAATCCCATCTAGCCTCAGAACTCCAGCTCCGAACAG GACCCAGCCAGAT

GGAGCAGGAGCTTCTGCACCTGGCCAGCAGCTCCCCCGTTGACCTGCTCTGTGCTCCTGTTCCTTCATGCCTGCCATCCCCTCAGCTAAGACCAGATCCT

GTCATCCTGAAGCCCGCTGATCTCATTCAGTTTGAGGAACACCCTCAAGAGCCTTTGG GAGTTTTAGTTTTAAACCAAGAAGAAAAATCAGAAGTTCCA

CTACCAGTGCAAAAGGGAAACCTGTCCTGTGACTCCTCACCCAGCAGCCCAGCAGCTTCTCCTGCTCCTCCTGGCCCCTCCTCAGAAGCCCCCAGGCCAC

TTTTCAGCAAGGATGCAGTGGAAAGCCCAGCCAAAAAGCAGCCCAAAAATAGAGTCAAATTGGCAGCCAACTTTTCTTTTGCACCTGTAACCAAGCTTTA

ACTCCCATTTGAACATGGAATTAAATTAGGATGGGGGAAAACTGTCTGACTCTACACACAAAAATGGGCTTAAAAACCTCATTTTATATCTTGACCCCAG

AAGCCACTTTCATTAATGGCACCTAGGGAAATGGTTGGGTTTTTGTTGTTGTTGTTGTTTTTTGTTTGTTTGTTTTTGTTTTTGTTTTATTTTTAAACTT

TTAGATAAACATGTTCTTCCTTTATTTCTCCCACTTATTTGAAAGAACTCTTCCATTAAGGAATCTGTAATATTTCACCAAATTTTTCTAGACTGTTGTG

AATTGTGGTGGTTGGGAAGAAATTCGCAGAGATCACTCAGCAGGAAGTGGCTTGAGTCCCATTGAGCAATCTCCATCATTTGTTTAAGCAAATGGATTTG

TGGTTGTTCGAGAAGCCAAGCATGCCCATGAGCCTGTGGGTCACACACTGGGGAATGAGTGAGTGGCAGGAGAGCCATTTTTAGGCTGACAGGAAAGTTC

CTGGCTTCTAGGTGACTTGTTGGTGTGCCTTGTTTTTTATGTAACTATGTCTGGTTAACCAGTGTAGCTTCATCCCATTTTTTTAAACATTTGCATTTGG

GGATTCCATTTAAGAGCTTTCTAGAAAGTTATTTCATGCTTCCCTTCTCTGTCTGTCCCAGTTTGATAAGGATAAGGTTAAGGAGAGGAGATGGCCTCGA

TGTCATGTATTTAAAGTCAGGGTTTAAATGACACATTGTGTGTTGAGAGGTGGCAATGGTAAGAGTCTGATTTTTTTAAACTATGCATTAAATGTATAAA

TTGTAAATCAGCTGAAGTGCTTCAAGAGGCGTGGGTTAGATACTATTGCCACTAAGAAGAGACCAGAGTTCTATCTGTAATGTGAAGGCCAAGTTTGATC

AGCCTATCCTTGTTCTTGCGATTTAAAAGTTGGCTGTAAATCTGGGAAGCTCTCCATGTGAAGATGTGTGTCCATGTTAGTTCATCTGGACGTCTCTC
Translation
 - UNI4745 - MEGKGTENPCSRTLGWFHQDNDAKPWLWKFSGCFSRPEQTLPLSSQT KEYMENKKAAVELKDIPSPLHVGSKFFPAVPLPDIRSLQ

QPKVQLSAIPKVSCCAHCPNEPSTSPMRFGGGSGSSGGSGSLIHTGSLLDSPSTGTVTCQVGSGFAFQSVSSLQNASTRNNLVGLSSDFPSMCVESNLPS

CKHLSCCGKLHFQSCHSNVHKLHQFQNLQGCASAGYFPCSDFPSGAPGHLEERLSHSELTPHLCTNSLHLNVAPPVCLKGSLYCEDCLNK - UNI3937

 - PARNSIIDAAKIWPNIPPPSTQPAPPAIPVCNGCGTKGMEKETSLLLATSLGKTASKFG GSPEVAVTGQVLETLPPIGVFWDIENCSVPSGRSATT

VVQRIREKFFRGHREAEFICVCDISKENKEVIQELNNCQ VTVAHINATAKNAADDKLRQSLRRFANTHTAPATVVLVST TDVNFALELSDLRHRHGFH

IILVHKNQASEALLHHANQLIRFEEFISDLPPRLPLKIP CHTLLYVYNLPANKDGKSISNRLRRLSDNCGGKVLSITGCSAILRFINQDSAERAQKRME

NEDVFGNRIIVSFTPKHREFFEAKSSNAIADKVKSPKKVKNTKLCLIKDTSEQSPSVKAMPGKVLQANSGSATKTTNIKSLQ ELCRMESKSGNRNSDHQ

QGHGRLAALPNSGPTASVPIVKNTGVTEPLYRSSQK KKENPSSQSTVNSPVEKKKREETVFQVSYPSAFSKLIASRQVSPLLTSQSWSPR RSMSPNLL

NRASPLAFNIANPSSGADCPDPFANGVDIQVSNVDYRLSRKELQQLLQEAFSKHGQ VKSVELSPHTDYQLKAIVQMRNLHEAICAVNSLHRHKIGSKKI

LVSLSTGAANKSLSLLS STETMSILQDAPACCLPLFKFIDIYEKK KYGHKLNVSDLYKLTDTIAIREQGNGRLVCLLPSNQARQSPLGSSQSHDGSSS

NCSPVLFEELEYHEPVCKQHCSNKDFS SELVFDPDSYKIPFVVLSLKVFAPQVHSLLQTHQGTVPLLS SFPDCYAAEFGDLEITQDSHKGVPLEHFIT

CIPGVNIATAQNGVKVVKWIHNKPPPPNTD DPWLLRSKSPVRNPQLIQFSREVIDLLKTQPSCILPVSNFIPSYHHHFGKQCRVSDYGYSKLIELLEAV

PHVLQ - UNI35265 - ILGMGSKRLMTLTHRAQVKRFTQDLLKLLKSQASKQVIVRDFSQAYHW - UNI35265 - WCFSKDWDVTEYGVCDLID

IISEIPDTTICLSQQDDDMVICIRKRE - UNI35265 - ERTQDEIERTKQFSKDVVDLLRHQPHFRMPFNKFIPSYHHHFGRQCKLAYYGFTKLLEL

LEAIPEILQ VLECGEEKILTLTEVERFKALAAQFVKLLRSQKGNCLMMTDLFTEYAKTFGYTFRLQDYDVSSVSALTQKLCHVVK VADMESGKQIQLI

NRKSLRSLTAQLLVLLMSWEGDAYLPVDELRRHYETTHSTPLNPCEYGFMTLTELLKSLPYLVE VCTNDKAEEYVKLTSLYLFAKNVRSLLHTYHYQQI

FLHEFSMAYNKYVGETLQPKTYGYSSVEELLGAIPQ VVWIKGHGHKRIVVLKNDMKN - UNI346 - NRLSSFDLFSVNHEDQPAVSRQILAVPESH

LASELQLRTG GPSQMEQELLHLASSSPVDLLCAPVPSCLPSPQLRPDPVILKPADLIQFEEHPQEPLG GVLVLNQEEKSEVPLPVQKGNLSCDSSPSS

PAASPAPPGPSSEAPRPLFSKDAVESPAKKQPKNRVKLAANFSFAPVTKL

For any suggestions or comments, please send an email to unitrap@crg.es