Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000060703 (Cd302)
Chromosomal location
Chr 2: 60090050 - 60122181 (-)
Description
CD302 antigen Gene [Source:MGI (curated);Acc:Cd302-002]
Human Ortholog
not available
Omim not available
UniTrap UNI35140
Vector Insertion
Chr 2: 60090049 - 60093155
Public Clones IST11217E7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 72% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000074606
Sequence
AGTCATGCCCCACGCAGCGCTGTCCTCGCTCGTGCTGCTGAGCCTCGCCACTGCCATCGTCGCCG ACTGTCCTTCATCTACCTGGGTCCAGTTCCAAGG

CAGCTGTTATGCTTTTCTTCAAGTAACCATCAATGTGGAAAACATAGAGGATGTCAGAAAACAGTGCACTGACCACG GGGCAGACATGGTAAGCATACA

CAATGAAGAGGAAAACGCGTTTATACTGGACACTTTGCAAAAGCGATGGAAGGGTCCAGATGATCTCCTGCTAGGCATGTTCTATGACACTGATG ATGC

AACTTTCAAGTGGTATGATCATTCAAATATGACATTCGACAAGTGGGCAGATCAAGATGGTGAGGACCTAGTTGATACCTGTGGTTTTCTGTACACCAAG

ACAGGTGAATGGAGAAAAGGGGATTGTGAAATCTCTTCTGTGGAGGGAACACTTTGCAAAGCAGCAA - UNI35140 - TCCCATATGACAAGAAGTA

TTTATCAG - UNI35140 - ATAACCACATTTTAATATCGACTCTGGTGATCGCTAGCACAGTAACTCTGGCAGTTTTGGGAGCGATCATTTGGTTCC

TCTATAGAAGAAACGCGCGCTCTGGCTTCACCTCTTTTTCACCTGCACCACTGTCACCTTACAGTGATGGCTGTGCCCTGGTAGTTGCAGAAGAAGATGA

ATATGCTGTTCAGCTGGACTAAGAGTTTGGTAATATCAGGCCAGCATATTGAATCCATTGACAATAATTTCCTGTGCAAGGTTTTCATATAAAAACTTGC

CACAAAAACTGAGCCTTTTATGGTTATTCTTATATCAGTATTTTCATGTATTAAATGTGACAAAACATTAACCTTCTAAGAAAAAATATATATAAAATAA

AAAATATAAAAATATTAAGTTTCAGAACAGGAACCATCCTGGATCTAACTTACACGTTTTCTTGTGTAGTTTTCATTTGAGTACATGAAAGCTGCAAGTA

CAATAAAGCTGGTAAAACGCC
Translation
MPHAALSSLVLLSLATAIVAD DCPSSTWVQFQGSCYAFLQVTINVENIEDVRKQCTDHG GADMVSIHNEEENAFILDTLQKRWKGPDDLLLGMFYDTD

D DATFKWYDHSNMTFDKWADQDGEDLVDTCGFLYTKTGEWRKGDCEISSVEGTLCKAAI - UNI35140 - IPYDKKYLSD - UNI35140 - DN

HILISTLVIASTVTLAVLGAIIWFLYRRNARSGFTSFSPAPLSPYSDGCALVVAEEDEYAVQLD
Transcript ENSMUST00000028356
Sequence
AGTCATGCCCCACGCAGCGCTGTCCTCGCTCGTGCTGCTGAGCCTCGCCACTGCCATCGTCGCCG ACTGTCCTTCATCTACCTGGGTCCAGTTCCAAGG

CAGCTGTTATGCTTTTCTTCAAGTAACCATCAATGTGGAAAACATAGAGGATGTCAGAAAACAGTGCACTGACCACG GGGCAGACATGGTAAGCATACA

CAATGAAGAGGAAAACGCGTTTATACTGGACACTTTGCAAAAGCGATGGAAGGGTCCAGATGATCTCCTGCTAGGCATGTTCTATGACACTGATG ATGC

AACTTTCAAGTGGTATGATCATTCAAATATGACATTCGACAAGTGGGCAGATCAAGATGGTGAGGACCTAGTTGATACCTGTGGTTTTCTGTACACCAAG

ACAGGTGAATGGAGAAAAGGGGATTGTGAAATCTCTTCTGTGGAGGGAACACTTTGCAAAGCAGCAA - UNI35140 - ATAACCACATTTTAATATC

GACTCTGGTGATCGCTAGCACAGTAACTCTGGCAGTTTTGGGAGCGATCATTTGGTTCCTCTATAGAAGAAACGCGCGCTCTGGCTTCACCTCTTTTTCA

CCTGCACCACTGTCACCTTACAGTGATGGCTGTGCCCTGGTAGTTGCAGAAGAAGATGAATATGCTGTTCAGCTGGACTAAGAGTTTGGTAATATCAGGC

CAGCATATTGAATCCATTGACAATAATTTCCTGTGCAAGGTTTTCATATAAAAACTTGCCACAAAAACTGAGCCTTTTATGGTTATTCTTATATCAGTAT

TTTCATGTATTAAATGTGACAAAACATTAACCTTCTAAGAAAAAATATATATAAAATAAAAAATATAAAAATATTAAGTTTCAGAACAGGAACCATCCTG

GATCTAACTTACACGTTTTCTTGTGTAGTTTTCATTTGAGTACATGAAAGCTGCAAGTACAATAAAGCTGGTAAAACGCC
Translation
MPHAALSSLVLLSLATAIVAD DCPSSTWVQFQGSCYAFLQVTINVENIEDVRKQCTDHG GADMVSIHNEEENAFILDTLQKRWKGPDDLLLGMFYDTD

D DATFKWYDHSNMTFDKWADQDGEDLVDTCGFLYTKTGEWRKGDCEISSVEGTLCKAAN - UNI35140 - NNHILISTLVIASTVTLAVLGAIIWF

LYRRNARSGFTSFSPAPLSPYSDGCALVVAEEDEYAVQLD

For any suggestions or comments, please send an email to unitrap@crg.es