Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000060726 (1700129I15Rik)
Chromosomal location
Chr X: 132253206 - 132259800 (-)
Description
RIKEN cDNA 1700129I15 gene Gene [Source:MGI Symbol;Acc:MGI:1925728]
RefSeq_dna
NM_030106 
RefSeq_peptide
NP_084382.1 
UniGene
Mm.391317 Mm.415353 
MGI
MGI:1925728 
Uniprot/SPTREMBL
Q9D2R9 A2AEH9 
Human Ortholog
not available
Omim not available
UniTrap UNI19872
Vector Insertion
Chr X: 132254204 - 132254310
Public Clones not available
Private Clones OST378359 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000073674
Sequence
GTGGCACCTATAAACTTGCAGGTACTGCAAGGGCAGCATCAGTTTGGCCCTGAAGCTAACTGAAGACAGAGCTGTTGGTCTGATAGGTGGAGCTGTTAGT

CTGATAG - UNI19872 - TCAAAATGGGTGATAGACCAGACTTGTCGGAAGTGGAGAGATTCGATAAATCCAAACTGAAGAAAACCATCACCGAAGT

AAAAAATACTCTGCCCTCGAAGGAAA - UNI19872 - CCATCGAGCAAGAGAAGGAGTTTGTGAAAAGATCATAATGAGGATCTTTTCCAACAAATA

AATGCCAACACTGGCAAGCAGTCTTGG
Translation
 - UNI19872 - MGDRPDLSEVERFDKSKLKKTITEVKNTLPSKET - UNI19872 - TIEQEKEFVKRS
Transcript ENSMUST00000113154
Sequence
ATACCCCTCTACCTTACCCCGCACTTCCGCGCCACCACCACTCCACAGCCCCGGGACGTCATGGCTAACAAACAGCTCTTGGCTTTAAATGGCAGATCCG

AGAAAACAAGATGTCTCAAGCCTTTCCTTTAAGCCCGAGGAATAGCTCAGGTCCGCCATGACTCTGGCCGTGACTGTGACACGGGAG ACCTCTGAACAT

GCAGAAACACTTCTGGACATTTATTATAACAGATTTGTTAACTGAGGTCTGGAGAGATGACTCATTG GTACTGCAAGGGCAGCATCAGTTTGGCCCTGA

AGCTAACTGAAGACAGAGCTGTTGGTCTGATAGGTGGAGCTGTTAGTCTGATAG - UNI19872 - TCAAAATGGGTGATAGACCAGACTTGTCGGAA

GTGGAGAGATTCGATAAATCCAAACTGAAGAAAACCATCACCGAAGTAAAAAATACTCTGCCCTCGAAGGAAA - UNI19872 - CCATCGAGCAAGA

GAAGGAGTTTGTGAAAAGATCATAATGAGGATCTTTTCCAACAAATAAATGCCAACACTGGCAAGCAGTCTTGG
Translation
 MTHW WYCKGSISLALKLTEDRAVGLIGGAVSLIV - UNI19872 - VKMGDRPDLSEVERFDKSKLKKTITEVKNTLPSKET - UNI19872 - 

TIEQEKEFVKRS
Transcript ENSMUST00000113152
Sequence
GTGACTCATAG GTACTGCAAGGGCAGCATCAGTTTGGCCCTGAAGCTAACTGAAGACAGAGCTGTTGGTCTGATAGGTGGAGCTGTTAGTCTGATAG -

 UNI19872 - TCAAAATGGGTGATAGACCAGACTTGTCGGAAGTGGAGAGATTCGATAAATCCAAACTGAAGAAAACCATCACCGAAGTAAAAAATAC

TCTGCCCTCGAAGGAAA - UNI19872 - CCATCGAGCAAGAGAAGGAGTTTGTGAAAAGATCATAATGAGGATCTTTTCCAACAAATAAATGCCAAC

ACTGGCAAGC
Translation
VTHR RYCKGSISLALKLTEDRAVGLIGGAVSLIV - UNI19872 - VKMGDRPDLSEVERFDKSKLKKTITEVKNTLPSKET - UNI19872 - T

IEQEKEFVKRS

For any suggestions or comments, please send an email to unitrap@crg.es