Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000060802 (B2m)
Chromosomal location
Chr 2: 121973422 - 121978610 (+)
Description
beta-2 microglobulin Gene [Source:MGI (curated);Acc:B2m-001]
RefSeq_dna
NM_009735 
RefSeq_peptide
NP_033865.2 
MGI
MGI:88127 
Uniprot/SWISSPROT
P01887 
Uniprot/SPTREMBL
Q3U679 Q91XJ8 Q9D239 
Human Ortholog
ENSG00000166710 (B2M)
Omim 241600 - HYPOPROTEINEMIA, HYPERCATABOLIC  
UniTrap UNI17157
Vector Insertion
Chr 2: 121973541 - 121976608
Public Clones not available
Private Clones OST448333 (lexicon) OST428475 (lexicon) OST409476 (lexicon) OST398637 (lexicon)
OST389815 (lexicon) OST372596 (lexicon) OST293591 (lexicon) OST272441 (lexicon)
OST256186 (lexicon) OST210489 (lexicon) OST203053 (lexicon) OST199195 (lexicon)
OST110785 (lexicon) OST35818 (lexicon)
Severity of mutation (?) Insertion after 19% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI13977
Vector Insertion
Chr 2: 121976888 - 121977382
Public Clones CMHD-GT_133B6-3 (cmhd)
Private Clones OST444744 (lexicon) OST320347 (lexicon) OST231053 (lexicon) OST222461 (lexicon)
OST218929 (lexicon) OST202957 (lexicon) OST168233 (lexicon) OST110819 (lexicon)
OST60053 (lexicon)
Severity of mutation (?) Insertion after 97% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000102476
Sequence
ATTTCAGTGGCTGCTACTCGGCGCTTCAGTCGCGGTCGCTTCAGTCGTCAGCATGGCTCGCTCGGTGACCCTGGTCTTTCTGGTGCTTGTCTCACTGACC

GGCCTGTATGCTATCCAGA - UNI17157 - AAACCCCTCAAATTCAAGTATACTCACGCCACCCACCGGAGAATGGGAAGCCGAACATACTGAACTG

CTACGTAACACAGTTCCACCCGCCTCACATTGAAATCCAAATGCTGAAGAACGGGAAAAAAATTCCTAAAGTAGAGATGTCAGATATGTCCTTCAGCAAG

GACTGGTCTTTCTATATCCTGGCTCACACTGAATTCACCCCCACTGAGACTGATACATACGCCTGCAGAGTTAAGCATGCCAGTATGGCCGAGCCCAAGA

CCGTCTACTGGG - UNI13977 - ATCGAGACATGTGATCAAGCATCATGATG CTCTGAAGATTCATTTGAACCTGCTTAATTACAAATCCAGTTTC

TAATATGCTATACAATTTATGCACGCAGAAAGAAATAGCAATGTACACATCACCTTCTTTATATCTTACTTTAAATATTTTATGCATGTTTTCAAAAAAT

TGGAAATATCCTAGATAGCTGAGCAATAAATCTTCAATAAGTATTTTGATCAGAATAATAAATATAATTTTAAGAACAAT
Translation
MARSVTLVFLVLVSLTGLYAIQK - UNI17157 - KTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYIL

AHTEFTPTETDTYACRVKHASMAEPKTVYWD - UNI13977 - DRDM 

For any suggestions or comments, please send an email to unitrap@crg.es