Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000060843 (Ctnna3)
Chromosomal location
Chr 10: 62892846 - 64466415 (+)
Description
catenin (cadherin associated protein), alpha 3 Gene [Source:MGI (curated);Acc:Ctnna3-001]
RefSeq_dna
NM_177612 
RefSeq_peptide
NP_808280.1 
UniGene
Mm.444692 
MGI
MGI:2661445 
Uniprot/SWISSPROT
Q65CL1 
Uniprot/SPTREMBL
A4GE64 A4GE65 Q14DP5 
Human Ortholog
ENSG00000183230 (CTNNA3)
Omim not available
UniTrap UNI36747
Vector Insertion
Chr 10: 62892928 - 62920257
Public Clones IST11677F5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32942
Vector Insertion
Chr 10: 62966884 - 63000268
Public Clones IST15104E1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31495
Vector Insertion
Chr 10: 63044812 - 63282969
Public Clones IST14226D12 (tigm) IST12365F2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 22% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI30967
Vector Insertion
Chr 10: 63872032 - 63950209
Public Clones IST14717G7 (tigm) IST12871D1 (tigm) IST14704G9 (tigm) IST11421C1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 51% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34050
Vector Insertion
Chr 10: 64138665 - 64297325
Public Clones IST12841A1 (tigm) IST15067E1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 70% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI34972
Vector Insertion
Chr 10: 64297419 - 64335908
Public Clones IST10381B12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 74% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000105440
Sequence
TCCCCTTTCTCTCTTATCCTGAGTGAATGGTGCTCAGCTAAAGGGACTGCCCCACCAGCTCTGTCTCTTTCCTCCCACCCTTCGAGCTCTCTTTGGAAAA

ATTCCCTCCAAAAGCTGAACCCAAAGCTCATTTACTTGTAGGAAGCATCAGAAAG GCAACATGTCGGCAGAAACGCCAATAACCCTGAATATGGACACT

CAGGATCTGCAGATCCAAACGTTCACTGTGGAGAAACTGCTGGAGCCTCTGATAATCCAG - UNI32942 - GTTACTACCCTGGTGAATTGTCCGCA

GAATCCTTCCAACAGGAAGAAAGGACGTTCAAAGAGAGCCAGAGTTCTTCTAGCTTCCGTGGAGGAAGCAACTTGGAATTTGTTAGACAAGGGGGAGATG

ATTGCTAAGGAAGCCACGGTTTTAAAGGAAGAGCTGGCAGCTGCACTCCAGGAAGTTCGAAAAGAGA GCAAAGCTCTGAAGGTATCAGCTGAGAGATTT

ACAGACGACCCCTGTTACCTCCCGAAAAGGGAGGCCGTGGTTCAAGCCGCCCGCGCCCTGTTGGCAGCAGTTACAAGACTCCTTGTTCTTGCCGACATGA

TTGATGTCATGTGCCTCTTGCAGCATGTGTCATCT TTCCAAAGAACATTCGAGTCTCTCAAAAATGTTTCCAACAAGTCCGACCTCCAGAGAACCTACC

AGAAGCTCGGGAAGGAGCTGGAAAGCCTGGATTATTTGGCCTTCAAACGCCAGCAG - UNI31495 - GACCTAAAATCTCCAAGCCAGAGGGATGAA

ATTGCAGGGGCCCGGGCCACCTTGAAGGAGAACTCCCCACTCCTGCATTCTATTTGTTCAGCATGCTTGGAACATTCCGATGTTGCTTCGCTCAAAGCCA

GTAAGGACACCGTCTGTGAAGAGATCCAGAACGCTCTTGATGTAATTTCAAATGCTTCCCAAGGCATCCAGAATGCGCCAGCGCCCCCTGAACCTCAGGC

AGCAACACTGGGAAGTGCTTTTGATGAGCTGGAG AACTTAATTGTCCTGAACCCACTCACAGTGACAGAGGAAGATGTAAGACCATCACTAGAGAAACG

CCTAGAAGCCATCATCAGTGGGGCCGCACTGTTGGCCGACTCGTCCTGCACCAGGGACCTCCACCGGGAGCGGATTATCGCCGAGTGCAATGCCATCCGC

CAGGCTCTCCAGGACCTGCTGACGGAGTACATGAGTAAT ACTGGAAAAACAGAAAGGAGTAATACCCTGAATACTGCCATTGTCAACATGAGCAAGAAG

ACAAGAGACCTCCGCAGACAG CTCCGCAAAGCTATCATAGATCACATATCAGATTCTTTCTTGGATACAACAGTTCCACTCCTGGTCCTCATTGAAGCT

GCGAAGAATGGCCGAGTCAAGGAAATCAAAGACTATGCTGCCATATTTCATGAGCACACTGGCAGGCTCGTGGAG GTGGCAAATCTGGCTTGTTCCATG

TCAACGAATGAAGATGGGATTAAAATCGTCAGAATTGCAGCCAATCACCTGGAGACCCTGTGTCCACAG - UNI30967 - ATCATAAATGCTGCACT

TGCTTTGGCATCAAGACCCAAGAGTCAAGTGGTCAAAAACACCATGGAAATGTACAAGCGCACATGGGAACACTACATCCACGTCCTCACTGAAGCTGTA

GATGACATCACCAGCATTGACGACTTTCTGGCTGTATCTG AAAGCCACATCCTGGAAGATGTCAACAAATGCATTATAGCCTTGAGAGATCAGGATGCT

GATAATTTAGACCGAGCTGCCGGTGCCATCAGAGGACGGGCCGCAAGAGTAGCTCACATCGTTGCGGGTGAAATGGATAGTTACGAACCCGGCGCTTACA

CCGAAGGTGTGATGAGAAATGTCAACTTCCTTACAAGCACTG TGATCCCGGAGTTCGTGACACAAGTGAATGTGGCCCTAGATGCTTTAAGCAAGAACT

CTCTGACTGCGCTTGATGATAATCAGTTTGTGGACATCTCCAAGAAGATCTATGACACAATCCATGATATCAGGTGTTCGGTCATGATGATTCGG - UN

I34050 - ACACCAGAGGAACTAGAGGATGTTTCTGACCTTGAAGATGACCATGAGGTCCGTAGCCACACCAGCATTCAGACAGAAGGGAAAACTGATC

GG - UNI34972 - GCCAAGATGACTCAACTGCCTGAGGCAGAAAAGGAAAAGATTGCTGAGCAAGTCGCCGACTTCAAGAAGGTGAAGAGCAAGCTG

GACGCTGAGATTGAGATATGGGATGACACAAGCAATGACATCATTGTTCTTGCCAAGAAGATGTGCATGATCATGATGGAGATGACCGACTTCACGAG G

GGGAAAGGACCACTAAAGCATACCACTGATGTAATCTATGCAGCTAAAATGATATCAGAGTCAGGATCAAGGATGGATGTTCTTGCTCGGCAGATTGCTA

ACCAG TGTCCAGATCCACCGTGCAAACAGGACTTGCTGGCTTACCTGGAACAGATTAAATTCTACTCCCACCAGCTGAAAATCTGCAGTCAAGTTAAAG

CAGAGATCCAAAATCTGGGGGGAGAACTCATCGTATCAGCT TTGGACAGTGTCACCTCCCTGATCCAGGCAGCCAAGAATTTAATGAATGCTGTAGTGC

AAACAGTGAAAATGTCATACATTGCCTCCACCAAGATCATCCGCATCCAGAGTTCTGCAGGACCCCGGCACCCAGTAGTCATGTGGAGGATGAAGGCTCC

GGCTAAGAAGCCCTTGATTAAAAGAGAGAAGCCAGAAGAAACATGGGCAGCTGTCAGAAGAGGCTCTGCCAAGAAAAAGATCCACCCAGTTCAAGTCATG

AGTGAATTCAGAGGGAGACAAGTCTACTGAATACCCTCATCCACTCTAGTGCCCATTTCTACACCCCAGGCTAACCACACTGCTTTATTTCATGGTTCAT

TGGTTCTTTAATTTCACCAAGTTTCAGAGTTAAGCTCACAAATAACATAAAACATTGGGGTTAAACAAGTGTGTAAGATGTGTGTTTGGGATCTTGTCAT

TGTGTACTCTATACGGCCAGCACAACCTAGTTAACTGGTTGGTAGTACCTAGGAAATAAAACTCACGGGTGTTGCTTACCACTACCCTTCAGAGGGAAGA

CTTATGTTCATTACAAAATGAGCGTAAGTGATAATGTGAGTTCCTATTACCCAGAAATGTCTGCACCCATGCATTCTATATCCCTGGGAAGGAAAACCCT

GACATACGCTTTGCACTTGCATTTTGCTAGACATAAAAGAGTTTATCAACTATTTTCCCAATTAGCATCCATACTTTCTTTAACCCACCTAACCTTGCAT

CTAACCTGCCAAAAATGTGTCACCCTAGCCCTGGGAAATTTTAATCACTGTTCATCATGAATAGGTTAGATACCTGTAACCGAGTGGGTGTGGCCAACCT

TCTTCCTAGAATTTAAAAGTCAGGCATGTTATTCAAGAAGTGCTTTGATGACCCTCTGTAGGCTGCCATCTTGGAACATAATGCTTGAACCTTGTATTTC

TATAGTGATCAGAAGTTCTGGACTCTTAGTATTGGGCTTATCAGAGCATACCTGTAGAGTCATCACCCACTGGAGAAGTGAATTTTTGTTTGTTGTTGGT

GTGGGGTTTTTTTTGTTTATTTGTTTGTTTGTTTTTGGTATTGGAAATAAAACATTTCACATTC
Translation
 MSAETPITLNMDTQDLQIQTFTVEKLLEPLIIQ - UNI32942 - VTTLVNCPQNPSNRKKGRSKRARVLLASVEEATWNLLDKGEMIAKEATVLKE

ELAAALQEVRKES SKALKVSAERFTDDPCYLPKREAVVQAARALLAAVTRLLVLADMIDVMCLLQHVSS FQRTFESLKNVSNKSDLQRTYQKLGKELE

SLDYLAFKRQQ - UNI31495 - DLKSPSQRDEIAGARATLKENSPLLHSICSACLEHSDVASLKASKDTVCEEIQNALDVISNASQGIQNAPAPPEP

QAATLGSAFDELE NLIVLNPLTVTEEDVRPSLEKRLEAIISGAALLADSSCTRDLHRERIIAECNAIRQALQDLLTEYMSN TGKTERSNTLNTAIVNM

SKKTRDLRRQ LRKAIIDHISDSFLDTTVPLLVLIEAAKNGRVKEIKDYAAIFHEHTGRLVE VANLACSMSTNEDGIKIVRIAANHLETLCPQ - UNI

30967 - IINAALALASRPKSQVVKNTMEMYKRTWEHYIHVLTEAVDDITSIDDFLAVSE ESHILEDVNKCIIALRDQDADNLDRAAGAIRGRAARVA

HIVAGEMDSYEPGAYTEGVMRNVNFLTSTV VIPEFVTQVNVALDALSKNSLTALDDNQFVDISKKIYDTIHDIRCSVMMIR - UNI34050 - TPEE

LEDVSDLEDDHEVRSHTSIQTEGKTDR - UNI34972 - AKMTQLPEAEKEKIAEQVADFKKVKSKLDAEIEIWDDTSNDIIVLAKKMCMIMMEMTDF

TR RGKGPLKHTTDVIYAAKMISESGSRMDVLARQIANQ CPDPPCKQDLLAYLEQIKFYSHQLKICSQVKAEIQNLGGELIVSA LDSVTSLIQAAKNL

MNAVVQTVKMSYIASTKIIRIQSSAGPRHPVVMWRMKAPAKKPLIKREKPEETWAAVRRGSAKKKIHPVQVMSEFRGRQVY
Transcript ENSMUST00000105441
Sequence
GTTTGAATTCCCCGCCCGGAGGCTGAGCGCAGGTTTCTCAGGAGGAGGCCGGAAGCCGAGGTGTCGAGCGACCTCCTGATAG - UNI36747 - GCAA

CATGTCGGCAGAAACGCCAATAACCCTGAATATGGACACTCAGGATCTGCAGATCCAAACGTTCACTGTGGAGAAACTGCTGGAGCCTCTGATAATCCAG

 - UNI32942 - GTTACTACCCTGGTGAATTGTCCGCAGAATCCTTCCAACAGGAAGAAAGGACGTTCAAAGAGAGCCAGAGTTCTTCTAGCTTCCGT

GGAGGAAGCAACTTGGAATTTGTTAGACAAGGGGGAGATGATTGCTAAGGAAGCCACGGTTTTAAAGGAAGAGCTGGCAGCTGCACTCCAGGAAGTTCGA

AAAGAGA GCAAAGCTCTGAAGGTATCAGCTGAGAGATTTACAGACGACCCCTGTTACCTCCCGAAAAGGGAGGCCGTGGTTCAAGCCGCCCGCGCCCTG

TTGGCAGCAGTTACAAGACTCCTTGTTCTTGCCGACATGATTGATGTCATGTGCCTCTTGCAGCATGTGTCATCT TTCCAAAGAACATTCGAGTCTCTC

AAAAATGTTTCCAACAAGTCCGACCTCCAGAGAACCTACCAGAAGCTCGGGAAGGAGCTGGAAAGCCTGGATTATTTGGCCTTCAAACGCCAGCAG - U

NI31495 - GACCTAAAATCTCCAAGCCAGAGGGATGAAATTGCAGGGGCCCGGGCCACCTTGAAGGAGAACTCCCCACTCCTGCATTCTATTTGTTCA

GCATGCTTGGAACATTCCGATGTTGCTTCGCTCAAAGCCAGTAAGGACACCGTCTGTGAAGAGATCCAGAACGCTCTTGATGTAATTTCAAATGCTTCCC

AAGGCATCCAGAATGCGCCAGCGCCCCCTGAACCTCAGGCAGCAACACTGGGAAGTGCTTTTGATGAGCTGGAG AACTTAATTGTCCTGAACCCACTCA

CAGTGACAGAGGAAGATGTAAGACCATCACTAGAGAAACGCCTAGAAGCCATCATCAGTGGGGCCGCACTGTTGGCCGACTCGTCCTGCACCAGGGACCT

CCACCGGGAGCGGATTATCGCCGAGTGCAATGCCATCCGCCAGGCTCTCCAGGACCTGCTGACGGAGTACATGAGTAAT ACTGGAAAAACAGAAAGGAG

TAATACCCTGAATACTGCCATTGTCAACATGAGCAAGAAGACAAGAGACCTCCGCAGACAG CTCCGCAAAGCTATCATAGATCACATATCAGATTCTTT

CTTGGATACAACAGTTCCACTCCTGGTCCTCATTGAAGCTGCGAAGAATGGCCGAGTCAAGGAAATCAAAGACTATGCTGCCATATTTCATGAGCACACT

GGCAGGCTCGTGGAG GTGGCAAATCTGGCTTGTTCCATGTCAACGAATGAAGATGGGATTAAAATCGTCAGAATTGCAGCCAATCACCTGGAGACCCTG

TGTCCACAG - UNI30967 - ATCATAAATGCTGCACTTGCTTTGGCATCAAGACCCAAGAGTCAAGTGGTCAAAAACACCATGGAAATGTACAAGCG

CACATGGGAACACTACATCCACGTCCTCACTGAAGCTGTAGATGACATCACCAGCATTGACGACTTTCTGGCTGTATCTG AAAGCCACATCCTGGAAGA

TGTCAACAAATGCATTATAGCCTTGAGAGATCAGGATGCTGATAATTTAGACCGAGCTGCCGGTGCCATCAGAGGACGGGCCGCAAGAGTAGCTCACATC

GTTGCGGGTGAAATGGATAGTTACGAACCCGGCGCTTACACCGAAGGTGTGATGAGAAATGTCAACTTCCTTACAAGCACTG TGATCCCGGAGTTCGTG

ACACAAGTGAATGTGGCCCTAGATGCTTTAAGCAAGAACTCTCTGACTGCGCTTGATGATAATCAGTTTGTGGACATCTCCAAGAAGATCTATGACACAA

TCCATGATATCAGGTGTTCGGTCATGATGATTCGG - UNI34050 - ACACCAGAGGAACTAGAGGATGTTTCTGACCTTGAAGATGACCATGAGGTC

CGTAGCCACACCAGCATTCAGACAGAAGGGAAAACTGATCGG - UNI34972 - GCCAAGATGACTCAACTGCCTGAGGCAGAAAAGGAAAAGATTGC

TGAGCAAGTCGCCGACTTCAAGAAGGTGAAGAGCAAGCTGGACGCTGAGATTGAGATATGGGATGACACAAGCAATGACATCATTGTTCTTGCCAAGAAG

ATGTGCATGATCATGATGGAGATGACCGACTTCACGAG GGGGAAAGGACCACTAAAGCATACCACTGATGTAATCTATGCAGCTAAAATGATATCAGAG

TCAGGATCAAGGATGGATGTTCTTGCTCGGCAGATTGCTAACCAG TGTCCAGATCCACCGTGCAAACAGGACTTGCTGGCTTACCTGGAACAGATTAAA

TTCTACTCCCACCAGCTGAAAATCTGCAGTCAAGTTAAAGCAGAGATCCAAAATCTGGGGGGAGAACTCATCGTATCAGCT TTGGACAGTGTCACCTCC

CTGATCCAGGCAGCCAAGAATTTAATGAATGCTGTAGTGCAAACAGTGAAAATGTCATACATTGCCTCCACCAAGATCATCCGCATCCAGAGTTCTGCAG

GACCCCGGCACCCAGTAGTCATGTGGAGGATGAAGGCTCCGGCTAAGAAGCCCTTGATTAAAAGAGAGAAGCCAGAAGAAACATGGGCAGCTGTCAGAAG

AGGCTCTGCCAAGAAAAAGATCCACCCAGTTCAAGTCATGAGTGAATTCAGAGGGAGACAAGTCTACTGAATACCCTCATCCACTCTAGTGCCCATTTCT

ACACCCCAGGCTAACCACACTGCTTTATTTCATGGTTCATTGGTTCTTTAATTTCACCAAGTTTCAGAGTTAAGCTCACAAATAACATAAAACATTGGGG

TT
Translation
 - UNI36747 - MSAETPITLNMDTQDLQIQTFTVEKLLEPLIIQ - UNI32942 - VTTLVNCPQNPSNRKKGRSKRARVLLASVEEATWNLLDK

GEMIAKEATVLKEELAAALQEVRKES SKALKVSAERFTDDPCYLPKREAVVQAARALLAAVTRLLVLADMIDVMCLLQHVSS FQRTFESLKNVSNKSD

LQRTYQKLGKELESLDYLAFKRQQ - UNI31495 - DLKSPSQRDEIAGARATLKENSPLLHSICSACLEHSDVASLKASKDTVCEEIQNALDVISNA

SQGIQNAPAPPEPQAATLGSAFDELE NLIVLNPLTVTEEDVRPSLEKRLEAIISGAALLADSSCTRDLHRERIIAECNAIRQALQDLLTEYMSN TGKT

ERSNTLNTAIVNMSKKTRDLRRQ LRKAIIDHISDSFLDTTVPLLVLIEAAKNGRVKEIKDYAAIFHEHTGRLVE VANLACSMSTNEDGIKIVRIAANH

LETLCPQ - UNI30967 - IINAALALASRPKSQVVKNTMEMYKRTWEHYIHVLTEAVDDITSIDDFLAVSE ESHILEDVNKCIIALRDQDADNLDR

AAGAIRGRAARVAHIVAGEMDSYEPGAYTEGVMRNVNFLTSTV VIPEFVTQVNVALDALSKNSLTALDDNQFVDISKKIYDTIHDIRCSVMMIR - UN

I34050 - TPEELEDVSDLEDDHEVRSHTSIQTEGKTDR - UNI34972 - AKMTQLPEAEKEKIAEQVADFKKVKSKLDAEIEIWDDTSNDIIVLA

KKMCMIMMEMTDFTR RGKGPLKHTTDVIYAAKMISESGSRMDVLARQIANQ CPDPPCKQDLLAYLEQIKFYSHQLKICSQVKAEIQNLGGELIVSA L

DSVTSLIQAAKNLMNAVVQTVKMSYIASTKIIRIQSSAGPRHPVVMWRMKAPAKKPLIKREKPEETWAAVRRGSAKKKIHPVQVMSEFRGRQVY
Transcript ENSMUST00000075099
Sequence
ATGTCGGCAGAAACGCCAATAACCCTGAATATGGACACTCAGGATCTGCAGATCCAAACGTTCACTGTGGAGAAACTGCTGGAGCCTCTGATAATCCAG 

- UNI32942 - GTTACTACCCTGGTGAATTGTCCGCAGAATCCTTCCAACAGGAAGAAAGGACGTTCAAAGAGAGCCAGAGTTCTTCTAGCTTCCGTG

GAGGAAGCAACTTGGAATTTGTTAGACAAGGGGGAGATGATTGCTAAGGAAGCCACGGTTTTAAAGGAAGAGCTGGCAGCTGCACTCCAGGAAGTTCGAA

AAGAGA GCAAAGCTCTGAAGGTATCAGCTGAGAGATTTACAGACGACCCCTGTTACCTCCCGAAAAGGGAGGCCGTGGTTCAAGCCGCCCGCGCCCTGT

TGGCAGCAGTTACAAGACTCCTTGTTCTTGCCGACATGATTGATGTCATGTGCCTCTTGCAGCATGTGTCATCT TTCCAAAGAACATTCGAGTCTCTCA

AAAATGTTTCCAACAAGTCCGACCTCCAGAGAACCTACCAGAAGCTCGGGAAGGAGCTGGAAAGCCTGGATTATTTGGCCTTCAAACGCCAGCAG - UN

I31495 - GACCTAAAATCTCCAAGCCAGAGGGATGAAATTGCAGGGGCCCGGGCCACCTTGAAGGAGAACTCCCCACTCCTGCATTCTATTTGTTCAG

CATGCTTGGAACATTCCGATGTTGCTTCGCTCAAAGCCAGTAAGGACACCGTCTGTGAAGAGATCCAGAACGCTCTTGATGTAATTTCAAATGCTTCCCA

AGGCATCCAGAATGCGCCAGCGCCCCCTGAACCTCAGGCAGCAACACTGGGAAGTGCTTTTGATGAGCTGGAG AACTTAATTGTCCTGAACCCACTCAC

AGTGACAGAGGAAGATGTAAGACCATCACTAGAGAAACGCCTAGAAGCCATCATCAGTGGGGCCGCACTGTTGGCCGACTCGTCCTGCACCAGGGACCTC

CACCGGGAGCGGATTATCGCCGAGTGCAATGCCATCCGCCAGGCTCTCCAGGACCTGCTGACGGAGTACATGAGTAAT ACTGGAAAAACAGAAAGGAGT

AATACCCTGAATACTGCCATTGTCAACATGAGCAAGAAGACAAGAGACCTCCGCAGACAG CTCCGCAAAGCTATCATAGATCACATATCAGATTCTTTC

TTGGATACAACAGTTCCACTCCTGGTCCTCATTGAAGCTGCGAAGAATGGCCGAGTCAAGGAAATCAAAGACTATGCTGCCATATTTCATGAGCACACTG

GCAGGCTCGTGGAG GTGGCAAATCTGGCTTGTTCCATGTCAACGAATGAAGATGGGATTAAAATCGTCAGAATTGCAGCCAATCACCTGGAGACCCTGT

GTCCACAG - UNI30967 - ATCATAAATGCTGCACTTGCTTTGGCATCAAGACCCAAGAGTCAAGTGGTCAAAAACACCATGGAAATGTACAAGCGC

ACATGGGAACACTACATCCACGTCCTCACTGAAGCTGTAGATGACATCACCAGCATTGACGACTTTCTGGCTGTATCTG AAAGCCACATCCTGGAAGAT

GTCAACAAATGCATTATAGCCTTGAGAGATCAGGATGCTGATAATTTAGACCGAGCTGCCGGTGCCATCAGAGGACGGGCCGCAAGAGTAGCTCACATCG

TTGCGGGTGAAATGGATAGTTACGAACCCGGCGCTTACACCGAAGGTGTGATGAGAAATGTCAACTTCCTTACAAGCACTG TGATCCCGGAGTTCGTGA

CACAAGTGAATGTGGCCCTAGATGCTTTAAGCAAGAACTCTCTGACTGCGCTTGATGATAATCAGTTTGTGGACATCTCCAAGAAGATCTATGACACAAT

CCATGATATCAGGTGTTCGGTCATGATGATTCGG - UNI34050 - ACACCAGAGGAACTAGAGGATGTTTCTGACCTTGAAGATGACCATGAGGTCC

GTAGCCACACCAGCATTCAGACAGAAGGGAAAACTGATCGG - UNI34972 - GCCAAGATGACTCAACTGCCTGAGGCAGAAAAGGAAAAGATTGCT

GAGCAAGTCGCCGACTTCAAGAAGGTGAAGAGCAAGCTGGACGCTGAGATTGAGATATGGGATGACACAAGCAATGACATCATTGTTCTTGCCAAGAAGA

TGTGCATGATCATGATGGAGATGACCGACTTCACGAG GGGGAAAGGACCACTAAAGCATACCACTGATGTAATCTATGCAGCTAAAATGATATCAGAGT

CAGGATCAAGGATGGATGTTCTTGCTCGGCAGATTGCTAACCAG TGTCCAGATCCACCGTGCAAACAGGACTTGCTGGCTTACCTGGAACAGATTAAAT

TCTACTCCCACCAGCTGAAAATCTGCAGTCAAGTTAAAGCAGAGATCCAAAATCTGGGGGGAGAACTCATCGTATCAGCT TTGGACAGTGTCACCTCCC

TGATCCAGGCAGCCAAGAATTTAATGAATGCTGTAGTGCAAACAGTGAAAATGTCATACATTGCCTCCACCAAGATCATCCGCATCCAGAGTTCTGCAGG

ACCCCGGCACCCAGTAGTCATGTGGAGGATGAAGGCTCCGGCTAAGAAGCCCTTGATTAAAAGAGAGAAGCCAGAAGAAACATGGGCAGCTGTCAGAAGA

GGCTCTGCCAAGAAAAAGATCCACCCAGTTCAAGTCATGAGTGAATTCAGAGGGAGACAAGTCTACTGAATACCCTCATCCACTCTAGTGCCCATTTCTA

CACCCCAGGCTAACCACACTGCTTTATTTCATGGTTCATTGGTTCTTTAATTTCACCAAGTTTCAGAGTTAAGCTCAC
Translation
MSAETPITLNMDTQDLQIQTFTVEKLLEPLIIQ - UNI32942 - VTTLVNCPQNPSNRKKGRSKRARVLLASVEEATWNLLDKGEMIAKEATVLKEE

LAAALQEVRKES SKALKVSAERFTDDPCYLPKREAVVQAARALLAAVTRLLVLADMIDVMCLLQHVSS FQRTFESLKNVSNKSDLQRTYQKLGKELES

LDYLAFKRQQ - UNI31495 - DLKSPSQRDEIAGARATLKENSPLLHSICSACLEHSDVASLKASKDTVCEEIQNALDVISNASQGIQNAPAPPEPQ

AATLGSAFDELE NLIVLNPLTVTEEDVRPSLEKRLEAIISGAALLADSSCTRDLHRERIIAECNAIRQALQDLLTEYMSN TGKTERSNTLNTAIVNMS

KKTRDLRRQ LRKAIIDHISDSFLDTTVPLLVLIEAAKNGRVKEIKDYAAIFHEHTGRLVE VANLACSMSTNEDGIKIVRIAANHLETLCPQ - UNI3

0967 - IINAALALASRPKSQVVKNTMEMYKRTWEHYIHVLTEAVDDITSIDDFLAVSE ESHILEDVNKCIIALRDQDADNLDRAAGAIRGRAARVAH

IVAGEMDSYEPGAYTEGVMRNVNFLTSTV VIPEFVTQVNVALDALSKNSLTALDDNQFVDISKKIYDTIHDIRCSVMMIR - UNI34050 - TPEEL

EDVSDLEDDHEVRSHTSIQTEGKTDR - UNI34972 - AKMTQLPEAEKEKIAEQVADFKKVKSKLDAEIEIWDDTSNDIIVLAKKMCMIMMEMTDFT

R RGKGPLKHTTDVIYAAKMISESGSRMDVLARQIANQ CPDPPCKQDLLAYLEQIKFYSHQLKICSQVKAEIQNLGGELIVSA LDSVTSLIQAAKNLM

NAVVQTVKMSYIASTKIIRIQSSAGPRHPVVMWRMKAPAKKPLIKREKPEETWAAVRRGSAKKKIHPVQVMSEFRGRQVY

For any suggestions or comments, please send an email to unitrap@crg.es