Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000060961 (Slc4a4)
Chromosomal location
Chr 5: 89316322 - 89664563 (+)
Description
solute carrier family 4 (anion exchanger), member 4 Gene [Source:MGI Symbol;Acc:MGI:1927555]
RefSeq_peptide
NP_061230.2 NP_001129732.1 
UniGene
Mm.41044 
MGI
MGI:1927555 
Uniprot/SWISSPROT
O88343 
Uniprot/SPTREMBL
A2VDF7 A7E1Z5 
Human Ortholog
ENSG00000080493 (SLC4A4)
Omim 604278 - RENAL TUBULAR ACIDOSIS, PROXIMAL, WITH OCULAR ABNORMALITIES AND MENTAL  
UniTrap UNI33246
Vector Insertion
Chr 5: 89626788 - 89628679
Public Clones IST12444H6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 71% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31094
Vector Insertion
Chr 5: 89628842 - 89643498
Public Clones (sanger) IST12667C9 (tigm) IST11012C7 (tigm) IST12137D3 (tigm) IST11036B7 (tigm)
IST12075D8 (tigm) IST10607A4 (tigm) IST12681C7 (tigm) IST12034F3 (tigm)
IST10120F8 (tigm) IST12157C12 (tigm) IST11443B2 (tigm) IST12469G2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 76% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000113216
Sequence
CCTTTTGAAAGGAGTGGAGAACCCAAGATATAGTTTGGCTCATCGGAACAGAGAGAGGCTTTGAGTTGTCCTTGGCTTTAGGGCGAAGATAAAGGATGTC

CACTGAAAATGTGGAAGGGAAGCCCAATAATCTTGGGGAGAGAGGAAGAGCCCGAAGCTCCACTTTCCTCAGGGTTTTCCAGCCAATGTTTAACCACAGT

ATTTTCACTTCTGCAGTCTCCCCGGCCGCAGAACGCATCCGATTCATCTTGGGAGAGGAAGATGACAGCCCGGCACCTCCTCAGCTCTTCACGGAACTCG

ATGAGCTTCTGGCTGTGGATGGACAGGAGATGGAATGGAAGGAGACAGCGAG GTGGATTAAGTTTGAAGAGAAAGTGGAGCAGGGTGGGGAGCGATGGA

GCAAACCCCATGTGGCCACCTTGTCCCTGCACAGCCTGTTTGAGCTGAGGACATGTATGGAGAAAGGATCCATCATGCTTGACCGGGAGGCATCTTCTCT

CCCACAGCTGGTGG AGTTGTTGGGAGAATCAAGAAAAGTCATCAGACCTGCTGGGTTCATCAGACCCTAGTGTCATTAGCTATCTAGGTTTTCCTACAT

GCCACCTACAAGATTACGACATGAAGTCTGATTTGAATCTGGTATAGAGATGGTTGGAATTTCATGAACAGAAGAAAAACTTCCAAACACTATTGACTGA

AGAGATGGAAGTATTGGAGCATTCATTCCTTCTTTTTATTGATCGATCGATTGACTGATTTTTGCTGGTCTCGGAGCTGATCAGCATGGTGATGAAAGTT

TTAGACCTGAACTTCTTTGCAAAGCTGTCTTTGTGTTCTTCAGTCCCATACTGAACTACCTTTAAGAGTTCCTGATCCCAGCAAGTCCCTCACTGTGCAT

ACACAGCAGAAGACAGAGGCCCACATTAAATCAGAGCCCCTTTAGCCAATAACCAAAAGGGAAGCTCTGACATCTGCTGCATGTAAGAAAGATTAAGTGA

TCGTTTGATGTTCTTGCTTAATTTCCCGTAACATTTTTTTTATTATCAGCTGCGGACTCTTTTCTAACCTCCATGAATTTACTTTGAACATTGTCATCCT

GTGTTAAAATTAGACACCACTAGGTCACTTTGAGGTATCATCACTCACTAATATGTTTGCTTCACAGTCCCTGGGGCAAGGAGGCAGAGTGCCAGGGCTG

TCATTCTGGAGCTGATAATTCAGAAAAACAGTTCAGAGCAAACCATACATCATGAGCAAAAGAAAGGGAGGAAATAAAAAGACCAGCTTTGCAGAGGAGA

GTAAACAAGTATAACCTGATAACAGGACAAAAATCCTCTGGAAGAATACAAACCTATGGAGAATAAATTACAAACCACAGAAAACCTTTGCTTCATTTTA

AACGACAGACGGCCGCTCGGTGCTGTGAGGTGCTGTAGGGATTAGTTCATTACTATTACAACCTTTTTCTTGCAGGGGATGAGGTAGGGATGCATATGCT

GGTAATTCTCAACTGGCTGTTACTCTCTCATAAATATCATGATGGGTTTTCTCCCAATAGGCCAATTTTGCTTCAGAAAAGGGAGGAAATAAATAATAGA

AAGTATGATTATATCCAGTAAACATGAGGGTGTTTCTCAGCCGTCTTTGTGGTCCATTTGCTATTGCCCCTCCTCATCCTCCTGAGAGGTAGAGCACCCA

CAGATCTTATGCCATGGCAAGCAGCTGCACAGGACTCAAGCCAGGCTCAGATGTCAGGTGTCATTCTTACAGTGAAATCAGCTTACCTGGGATTCTTTTC

AGGACCTCTCTGTGCTTTTAATTTTTTTTTAAAAAAGAATCCCTTCTGTATTTTAATAGAAAAATTGTCTTTGAAGCATTACAGAGGATAAGACATAATT

TCCAGGGATTATTTTAATAGGTTTATTATTAGCACTCCATTGTAATCCTACATTTAAAGGGTGTCACTCACATACAAAGTCAAGTTCATGGAAGATTCTT

CCCTTCTTTTGTTTAAAAAAAGCTGTAATCCATTTCAGGTAATTAGCACAATGAGAAATGGATGAGCAAAATGTAGCTCTATTTTTGGAAAATATATATA

CATATGTGTATATATATACACACACACATATATATATACACATATACATACATACATATATATACACACACATATATGTACACACATACACACATATGTA

TACACACACACACACACACACATATATATATATATGTATATGTATATATATATATATATACACGTATATACATACATACATATGTGTACACACACACACA

CACCCTGAGCTCTGTGTGTTGGCAAATGTATGAGTTCTGCTGTTTTTTGTTGTTGTTTTTTTTTCCTTAAAAAAACTTTATATTTTCAAATTTGTATTTT

TTTGTTCTTTCTAATCTTAAAATTGACATATATCCATTTAAATATGCTCCATCAATACTTTACTACAAAAATAAAACCTTCCCTAATTTTACCACAAAAA

TAAAATGTTTCCTAATCT
Translation
MSTENVEGKPNNLGERGRARSSTFLRVFQPMFNHSIFTSAVSPAAERIRFILGEEDDSPAPPQLFTELDELLAVDGQEMEWKETAR RWIKFEEKVEQGG

ERWSKPHVATLSLHSLFELRTCMEKGSIMLDREASSLPQLVE ELLGESRKVIRPAGFIRP
Transcript ENSMUST00000066831
Sequence
AGGAGCGACGGAAGCCCGACCCCAGGAG GATGGAGGATGAAGCTGTCCTGGACAGAGGGGCTTCCTTCCTTAAACATGTGTGTGATGAAGAAGAAGTAG

AAG GTCACCACACGATCTACATTGGGGTCCATGTGCCCAAGAGCTACCGGAGAAGGAGACGCCACAAGAGGAAGGCTGGGCACAAGGAAAAGAAGGAAA

AGGAGAGAATCTCCGAGAACTACTCCGACAAATCTGATGTGGAGAATGCGGATGAGTCCAGCAGCAGTATCCTCAAACCCCTCA TCTCCCCGGCCGCAG

AACGCATCCGATTCATCTTGGGAGAGGAAGATGACAGCCCGGCACCTCCTCAGCTCTTCACGGAACTCGATGAGCTTCTGGCTGTGGATGGACAGGAGAT

GGAATGGAAGGAGACAGCGAG GTGGATTAAGTTTGAAGAGAAAGTGGAGCAGGGTGGGGAGCGATGGAGCAAACCCCATGTGGCCACCTTGTCCCTGCA

CAGCCTGTTTGAGCTGAGGACATGTATGGAGAAAGGATCCATCATGCTTGACCGGGAGGCATCTTCTCTCCCACAGCTGGTGG AGATGATTGCAGACCA

CCAGATCGAGACAGGCCTACTGAAGCCTGACCTGAAGGATAAGGTCACCTATACTCTGCTCCGGAAACATCGACATCAAACCAAGAAATCCAACCTTCGG

TCCCTGGCTGACATTGGGAAGACTGTCTCCAGTGCAAGTAGGATGTTTAGCAACCCTGATAATG GCAGCCCAGCCATGACCCACAGGAATCTGACATCC

TCCAGTCTCAATGACATTTCTGATAAACCAGAGAAGGATCAG CTGAAGAATAAATTCATGAAAAAACTGCCCCGAGATGCGGAAGCTTCCAATGTGCTT

GTTGGGGAGGTTGACTTCTTGGACACTCCCTTCATTGCCTTTGTTCGCCTACAGCAGGCTGTCATGCTGGGTGCCCTGACTGAGGTCCCTGTGCCCACAA

G GTTCTTGTTCATTCTCTTAGGTCCAAAGGGGAAAGCCAAGTCCTACCATGAGATTGGAAGAGCTATCGCCACCTTGATGTCTGACGAG GTGTTCCAC

GACATCGCTTACAAAGCGAAAGACAGACACGACCTGATTGCTGGCATTGATGAGTTCTTAGATGAAGTCATTGTCCTTCCACCTGGGGAATGGGACCCCA

CAATCCGAATAGAGCCTCCAAAGAGTCTCCCATCATCTGACAAAAG AAAGAATATGTACTCAGGTGGAGAGAATGTTCAGATGAATGGGGACACACCTC

ATGATGGAGGCCACGGAGGAGGAGGACATGGTGACTGTGAAGAACTACAGAGAACTGGCCG GTTCTGCGGTGGATTAATTAAGGACATAAAGAGGAAAG

CACCATTTTTTGCCAGTGACTTTTATGATGCTTTAAACATTCAGGCTCTCTCTGCGATTCTCTTCATTTATCTGGCAACCGTAACCAACGCCATCACTTT

TGGAGGCCTGCTCGGGGATGCCACCGACAACATGCAG GGTGTGTTGGAGAGTTTCCTGGGCACTGCTGTCTCCGGAGCCATCTTCTGCCTTTTTGCGGG

TCAACCGCTTACCATCTTGAGCAGCACGGGACCAGTGTTGGTGTTTGAGAGGCTTCTTTTTAACTTCAGCAA GGACCATAATTTTGACTACTTGGAGTT

TCGTCTTTGGATTGGCCTGTGGTCAGCCTTCATGTGTCTTGTCCTGGTGGCCACTGATGCGAGCTTCCTGGTTCAGTACTTCACCCGTTTCACAGAAGAA

GGTTTCTCCTCTCTCATCAGCTTCATCTTCATCTATGATGCTTTCAAGAAGATGATCAAGCTAGCAGATTACTATCCCATCAACTCTGACTTCAAAGTGG

GTTACAATACTCACTTCTCTTGTGCTTGCCTGCCACCCGACCCAG TTAATCTCTCAGTATCTAATGATACCACACTAGCCCCAGAGGACCTGCCGACCA

TTTCTTCTACTGACATG TACCATAATGTCACCTTTGACTGGGCCTATTTGTCAAAGAAGGAGTGTGTGAAGTATGGAGGGAAGCTCGTGGGAAACAACT

GTGACTTCGTGCCTGATATCACACTCATGTCCTTCATTCTCTTCCTGGGCACTTACACCTCGTCTATGGCTATGAAGAAATTCAAAACCAGTCGCTATTT

TCCAACCACA GCAAGAAAACTGATCAGTGATTTTGCCATTATCCTGTCCATTCTCATATTCTGTGTAATAGATGCCCTAGTCGGCGTGGACACTCCGAA

GCTCATTGTACCAAGTGAGTTCAAG - UNI33246 - CCAACAAGTCCTAACAGGGGTTGGTTTGTCCCGCCATTTGGAGGAAACCCTTGGTGGGTGT

GCCTTGCTGCTGCCATCCCGGCTTTGCTAGTCACCATCCTGATTTTCATGGACCAGCAGATCACCGCTGTGATTGTGAACAGGAAAGAGCATAAACTCAA

G - UNI31094 - AAAGGAGCTGGGTATCACCTGGATCTGTTTTGGGTCGCCATCCTCATGGTGGTATGCTCCTTCATGGCTCTTCCCTGGTATGTGG

CTGCTACTGTTATCTCCATTGCCCACATTGACAGTCTGAAGATGGAGACGGAGACATCTGCGCCTGGAGAACAACCAAAATTTCTGGGAGTAAG GGAAC

AACGAGTCACTGGAACCCTTGTGTTTATTCTGACTGGCCTGTCAGTCTTCATGGCTCCCATCCTGAAG TTTATCCCGATGCCTGTGCTGTATGGTGTGT

TCCTGTATATGGGGGTGGCCTCACTTAACGGTGTGCAG TTCATGGACCGTCTCAAGCTGCTGCTGATGCCCTTGAAGCATCAGCCCGACTTCATCTACC

TGCGCCACGTCCCCCTCCGCCGAGTCCACCTGTTCACCTTCCTGCAGGTGTTGTGCCTGGCTCTGCTCTGGATCCTCAAGTCAACAGTGGCTGCAATTAT

TTTTCCTGTTATG ATCCTGGCCCTGGTAGCAGTCAGAAAAGGTATGGATTACCTCTTCTCCCAGCACGACCTCAGCTTCCTTGATGATGTCATTCCAGA

AAAGGACAAGAAAAAGAAGGAGGACGAGAAGAAAAAGAAAAAGAAGAAAGGAAGTTTGGATAGCGACAATGACGAT TCTGACTGCCCATACTCAGAAAA

GGTCCCCAGTATTAAAATTCCAATGGACATCATGGAACAGCAACCTTTCCTAAGTGATAACAAACCCTTGGACA GAGAAAGATCCTCAACATTCCTCGA

ACGCCACACATCATGCTGATAAAATTCCTTTCCTTGAGTCGCTGGG
Translation
 MEDEAVLDRGASFLKHVCDEEEVEG GHHTIYIGVHVPKSYRRRRRHKRKAGHKEKKEKERISENYSDKSDVENADESSSSILKPLI ISPAAERIRFI

LGEEDDSPAPPQLFTELDELLAVDGQEMEWKETAR RWIKFEEKVEQGGERWSKPHVATLSLHSLFELRTCMEKGSIMLDREASSLPQLVE EMIADHQI

ETGLLKPDLKDKVTYTLLRKHRHQTKKSNLRSLADIGKTVSSASRMFSNPDNG GSPAMTHRNLTSSSLNDISDKPEKDQ LKNKFMKKLPRDAEASNVL

VGEVDFLDTPFIAFVRLQQAVMLGALTEVPVPTR RFLFILLGPKGKAKSYHEIGRAIATLMSDE VFHDIAYKAKDRHDLIAGIDEFLDEVIVLPPGEW

DPTIRIEPPKSLPSSDKR RKNMYSGGENVQMNGDTPHDGGHGGGGHGDCEELQRTGR RFCGGLIKDIKRKAPFFASDFYDALNIQALSAILFIYLATV

TNAITFGGLLGDATDNMQ GVLESFLGTAVSGAIFCLFAGQPLTILSSTGPVLVFERLLFNFSK KDHNFDYLEFRLWIGLWSAFMCLVLVATDASFLVQ

YFTRFTEEGFSSLISFIFIYDAFKKMIKLADYYPINSDFKVGYNTHFSCACLPPDPV VNLSVSNDTTLAPEDLPTISSTDM YHNVTFDWAYLSKKECV

KYGGKLVGNNCDFVPDITLMSFILFLGTYTSSMAMKKFKTSRYFPTT ARKLISDFAIILSILIFCVIDALVGVDTPKLIVPSEFK - UNI33246 - 

PTSPNRGWFVPPFGGNPWWVCLAAAIPALLVTILIFMDQQITAVIVNRKEHKLK - UNI31094 - KGAGYHLDLFWVAILMVVCSFMALPWYVAATV

ISIAHIDSLKMETETSAPGEQPKFLGVR REQRVTGTLVFILTGLSVFMAPILK FIPMPVLYGVFLYMGVASLNGVQ FMDRLKLLLMPLKHQPDFIYL

RHVPLRRVHLFTFLQVLCLALLWILKSTVAAIIFPVM ILALVAVRKGMDYLFSQHDLSFLDDVIPEKDKKKKEDEKKKKKKKGSLDSDNDD SDCPYSE

KVPSIKIPMDIMEQQPFLSDNKPLDR RERSSTFLERHTSC
Transcript ENSMUST00000113218
Sequence
AGGAGCGACGGAAGCCCGACCCCAGGAG GATGGAGGATGAAGCTGTCCTGGACAGAGGGGCTTCCTTCCTTAAACATGTGTGTGATGAAGAAGAAGTAG

AAG GTCACCACACGATCTACATTGGGGTCCATGTGCCCAAGAGCTACCGGAGAAGGAGACGCCACAAGAGGAAGGCTGGGCACAAGGAAAAGAAGGAAA

AGGAGAGAATCTCCGAGAACTACTCCGACAAATCTGATGTGGAGAATGCGGATGAGTCCAGCAGCAGTATCCTCAAACCCCTCA TCTCCCCGGCCGCAG

AACGCATCCGATTCATCTTGGGAGAGGAAGATGACAGCCCGGCACCTCCTCAGCTCTTCACGGAACTCGATGAGCTTCTGGCTGTGGATGGACAGGAGAT

GGAATGGAAGGAGACAGCGAG GTGGATTAAGTTTGAAGAGAAAGTGGAGCAGGGTGGGGAGCGATGGAGCAAACCCCATGTGGCCACCTTGTCCCTGCA

CAGCCTGTTTGAGCTGAGGACATGTATGGAGAAAGGATCCATCATGCTTGACCGGGAGGCATCTTCTCTCCCACAGCTGGTGG AGATGATTGCAGACCA

CCAGATCGAGACAGGCCTACTGAAGCCTGACCTGAAGGATAAGGTCACCTATACTCTGCTCCGGAAACATCGACATCAAACCAAGAAATCCAACCTTCGG

TCCCTGGCTGACATTGGGAAGACTGTCTCCAGTGCAAGTAGGATGTTTAGCAACCCTGATAATG GCAGCCCAGCCATGACCCACAGGAATCTGACATCC

TCCAGTCTCAATGACATTTCTGATAAACCAGAGAAGGATCAG CTGAAGAATAAATTCATGAAAAAACTGCCCCGAGATGCGGAAGCTTCCAATGTGCTT

GTTGGGGAGGTTGACTTCTTGGACACTCCCTTCATTGCCTTTGTTCGCCTACAGCAGGCTGTCATGCTGGGTGCCCTGACTGAGGTCCCTGTGCCCACAA

G GTTCTTGTTCATTCTCTTAGGTCCAAAGGGGAAAGCCAAGTCCTACCATGAGATTGGAAGAGCTATCGCCACCTTGATGTCTGACGAG GTGTTCCAC

GACATCGCTTACAAAGCGAAAGACAGACACGACCTGATTGCTGGCATTGATGAGTTCTTAGATGAAGTCATTGTCCTTCCACCTGGGGAATGGGACCCCA

CAATCCGAATAGAGCCTCCAAAGAGTCTCCCATCATCTGACAAAAG AAAGAATATGTACTCAGGTGGAGAGAATGTTCAGATGAATGGGGACACACCTC

ATGATGGAGGCCACGGAGGAGGAGGACATGGTGACTGTGAAGAACTACAGAGAACTGGCCG GTTCTGCGGTGGATTAATTAAGGACATAAAGAGGAAAG

CACCATTTTTTGCCAGTGACTTTTATGATGCTTTAAACATTCAGGCTCTCTCTGCGATTCTCTTCATTTATCTGGCAACCGTAACCAACGCCATCACTTT

TGGAGGCCTGCTCGGGGATGCCACCGACAACATGCAG GGTGTGTTGGAGAGTTTCCTGGGCACTGCTGTCTCCGGAGCCATCTTCTGCCTTTTTGCGGG

TCAACCGCTTACCATCTTGAGCAGCACGGGACCAGTGTTGGTGTTTGAGAGGCTTCTTTTTAACTTCAGCAA GGACCATAATTTTGACTACTTGGAGTT

TCGTCTTTGGATTGGCCTGTGGTCAGCCTTCATGTGTCTTGTCCTGGTGGCCACTGATGCGAGCTTCCTGGTTCAGTACTTCACCCGTTTCACAGAAGAA

GGTTTCTCCTCTCTCATCAGCTTCATCTTCATCTATGATGCTTTCAAGAAGATGATCAAGCTAGCAGATTACTATCCCATCAACTCTGACTTCAAAGTGG

GTTACAATACTCACTTCTCTTGTGCTTGCCTGCCACCCGACCCAG TTAATCTCTCAGTATCTAATGATACCACACTAGCCCCAGAGGACCTGCCGACCA

TTTCTTCTACTGACATG TACCATAATGTCACCTTTGACTGGGCCTATTTGTCAAAGAAGGAGTGTGTGAAGTATGGAGGGAAGCTCGTGGGAAACAACT

GTGACTTCGTGCCTGATATCACACTCATGTCCTTCATTCTCTTCCTGGGCACTTACACCTCGTCTATGGCTATGAAGAAATTCAAAACCAGTCGCTATTT

TCCAACCACA GCAAGAAAACTGATCAGTGATTTTGCCATTATCCTGTCCATTCTCATATTCTGTGTAATAGATGCCCTAGTCGGCGTGGACACTCCGAA

GCTCATTGTACCAAGTGAGTTCAAG - UNI33246 - CCAACAAGTCCTAACAGGGGTTGGTTTGTCCCGCCATTTGGAGGAAACCCTTGGTGGGTGT

GCCTTGCTGCTGCCATCCCGGCTTTGCTAGTCACCATCCTGATTTTCATGGACCAGCAGATCACCGCTGTGATTGTGAACAGGAAAGAGCATAAACTCAA

G - UNI31094 - AAAGGAGCTGGGTATCACCTGGATCTGTTTTGGGTCGCCATCCTCATGGTGGTATGCTCCTTCATGGCTCTTCCCTGGTATGTGG

CTGCTACTGTTATCTCCATTGCCCACATTGACAGTCTGAAGATGGAGACGGAGACATCTGCGCCTGGAGAACAACCAAAATTTCTGGGAGTAAG GGAAC

AACGAGTCACTGGAACCCTTGTGTTTATTCTGACTGGCCTGTCAGTCTTCATGGCTCCCATCCTGAAG TTTATCCCGATGCCTGTGCTGTATGGTGTGT

TCCTGTATATGGGGGTGGCCTCACTTAACGGTGTGCAG TTCATGGACCGTCTCAAGCTGCTGCTGATGCCCTTGAAGCATCAGCCCGACTTCATCTACC

TGCGCCACGTCCCCCTCCGCCGAGTCCACCTGTTCACCTTCCTGCAGGTGTTGTGCCTGGCTCTGCTCTGGATCCTCAAGTCAACAGTGGCTGCAATTAT

TTTTCCTGTTATG ATCCTGGCCCTGGTAGCAGTCAGAAAAGGTATGGATTACCTCTTCTCCCAGCACGACCTCAGCTTCCTTGATGATGTCATTCCAGA

AAAGGACAAGAAAAAGAAGGAGGACGAGAAGAAAAAGAAAAAGAAGAAAGGAAGTTTGGATAGCGACAATGACGAT TCTGACTGCCCATACTCAGAAAA

GGTCCCCAGTATTAAAATTCCAATGGACATCATGGAACAGCAACCTTTCCTAAGTGATAACAAACCCTTGGACA GAGAAAGATCCTCAACATTCCTCGA

ACGCCACACATCATGCTGATAAAATTCCTTTCCTTGAGTCGCTGGGTTTACCCAG TCCTCCAAGAACTCCAGTGAAAGTCGTGCCTC
Translation
 MEDEAVLDRGASFLKHVCDEEEVEG GHHTIYIGVHVPKSYRRRRRHKRKAGHKEKKEKERISENYSDKSDVENADESSSSILKPLI ISPAAERIRFI

LGEEDDSPAPPQLFTELDELLAVDGQEMEWKETAR RWIKFEEKVEQGGERWSKPHVATLSLHSLFELRTCMEKGSIMLDREASSLPQLVE EMIADHQI

ETGLLKPDLKDKVTYTLLRKHRHQTKKSNLRSLADIGKTVSSASRMFSNPDNG GSPAMTHRNLTSSSLNDISDKPEKDQ LKNKFMKKLPRDAEASNVL

VGEVDFLDTPFIAFVRLQQAVMLGALTEVPVPTR RFLFILLGPKGKAKSYHEIGRAIATLMSDE VFHDIAYKAKDRHDLIAGIDEFLDEVIVLPPGEW

DPTIRIEPPKSLPSSDKR RKNMYSGGENVQMNGDTPHDGGHGGGGHGDCEELQRTGR RFCGGLIKDIKRKAPFFASDFYDALNIQALSAILFIYLATV

TNAITFGGLLGDATDNMQ GVLESFLGTAVSGAIFCLFAGQPLTILSSTGPVLVFERLLFNFSK KDHNFDYLEFRLWIGLWSAFMCLVLVATDASFLVQ

YFTRFTEEGFSSLISFIFIYDAFKKMIKLADYYPINSDFKVGYNTHFSCACLPPDPV VNLSVSNDTTLAPEDLPTISSTDM YHNVTFDWAYLSKKECV

KYGGKLVGNNCDFVPDITLMSFILFLGTYTSSMAMKKFKTSRYFPTT ARKLISDFAIILSILIFCVIDALVGVDTPKLIVPSEFK - UNI33246 - 

PTSPNRGWFVPPFGGNPWWVCLAAAIPALLVTILIFMDQQITAVIVNRKEHKLK - UNI31094 - KGAGYHLDLFWVAILMVVCSFMALPWYVAATV

ISIAHIDSLKMETETSAPGEQPKFLGVR REQRVTGTLVFILTGLSVFMAPILK FIPMPVLYGVFLYMGVASLNGVQ FMDRLKLLLMPLKHQPDFIYL

RHVPLRRVHLFTFLQVLCLALLWILKSTVAAIIFPVM ILALVAVRKGMDYLFSQHDLSFLDDVIPEKDKKKKEDEKKKKKKKGSLDSDNDD SDCPYSE

KVPSIKIPMDIMEQQPFLSDNKPLDR RERSSTFLERHTSC 

For any suggestions or comments, please send an email to unitrap@crg.es