Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000060989 (AL805912.5)
Chromosomal location
Chr 4: 12159935 - 12161837 (+)
Description
not available
UniGene
Mm.402346 Mm.414263 Mm.432196 Mm.443356 Mm.462192 
Human Ortholog
not available
Omim not available
UniTrap UNI5038
Vector Insertion
Chr 4: 12160691 - 12160855
Public Clones STA016 (baygenomics) YTC491 (baygenomics) P116C10 (ggtc) P135A12 (ggtc)
M120H03 (ggtc) P135B01 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 75% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000071732
Sequence
GTCCCATATTGAACTCGAGTTGGAAGAGGCGAGTCCGGTCTCAAAATGGAGGTAAAACCGCCGCCCGGTTGCCCCCAGCCTGACTCCGGCCGTCGCCGCC

GCCGCCGGGGGGAGGAGGGCCATGATCCAAAGGAACCAGAGCAGCTGAGGAAGCTATTTATTGGTGGTCTGAGCTTTGAAACCACAGATGATAGCTTAAG

AGAACATTTTGAGAAATGGGGCACACTTACAGACTGTGTGGTAATGAGAGATCCCCAAACAAAACGTTCCAGAGGCTTTGGTTTTGTGACCTACTCTTGT

GTTGAAGAGGTGGATGCTGCAATGTGTGCTCGGCCACACAAGGTTGATGGGCGTGTGGTGGAACCGAAGAGAGCTGTTTCTAGAGAGGATTCTGTAAAGC

CTGGTGCCCATTTAACGGTGAAGAAAATTTTTGTTGGTGGTATTAAAGAGGATACGGAAGAATATAACCTGAGAGACTACTTTGAAAAGTATGGCAAGAT

TGAAACCATAGAGGTTATGGAAGACAGGCAGAGTGGGAAAAAGAGAGGATTTGCTTTTGTAACTTTTGATGATCATGACACAGTTGATAAAATTGTTGTT

CAGAAATACCACACTATTAATGGGCATAATTGTGAAGTGAAAAAGGCCCTTTCTAAACAAGAGATGCAGTCTGCTGGATCACAGAGAGGTCGTGGAGGTG

GATCTGGCAACTTTATGGGTCGTGGAGGAAACTTTGGTCGTGGAGGAAACTTTGGT - UNI5036 - GGTGGTGGATATGGTGGTGGAGGAGGAGGCT

ATGATGGTTACAATGAAGGAGGAAATTTTGGTGGAGGTAACTATGGTGGTGGTGGAAACTATAATGACTTTGGAAATTATAGTGGACAGCAACAATCAAA

TTATGGACCCATGAAGGGGGGCAGTTTTGGTGGAAGAAGCTCAGGCAGTCCCTATGGTGGTGGCTATGGATCTGGAGGTGGAAGTGGTGGATATGGTAGC

AGAAGGTTTTAAAATAAAACAGAAACGGCTACAGTTCTTAGCAGGAGAGAGAGCGAGGAGTTGTCAGGAAAGCTGCAGGTTACTTTGAGACAGTCGTCCC

AAATGCATTAGAGGAACTGTAAAAATCTGCCACAGAAGGAACGATGATCCATAGTCAGAAAAGTTACTGCAGCTTAAACAGGAAACCCTTCTTGTTCAGG

ACTGTCATAGCCACAGTTTGCAAAAAGTGCAGCTATTGATTAATGCAATGTAGTGTCAATTAGATGTACATTCCTGAGGTCTTTTATCTGTTGTAGCTTT

GTCTTTTTCTTTTTCTTTTCATTACATCAGGTATATTGCCCTGTAAATTGTGGTAGTGGTACCAGGAATAAAAAATTAAGGAATTTTTAACTTTTCAATA

TTTGTGTAGTTCAGTTTTTCTACATTTTAGTACAGAAACTTTAACAAAATGCAGTTTCGAAGGTGTTTCCTTGTGAGTTAACACGTGAAGAAGATCATTG

TTAATTACTATTTTGTATGAATTTTGCTAAAGTTAACTGTAAAGAAACACCTACTGACTTGCAATTTAAGGGGAATCTATTCTCCCCATTTCCAAAACAA

TGATGAATGGGCGCTGACATGTGGAGAGAATAGATATTTGTATGTTTGCAATGTGTGTTTTAGATAATTAGAATTGGGAAATAAAAAAATAGCATATTTG

TGAATTTAATAGCATTAAGATTACCTTCAAATGAAAAAGATCTCAAAAGTT
Translation
MEVKPPPGCPQPDSGRRRRRRGEEGHDPKEPEQLRKLFIGGLSFETTDDSLREHFEKWGTLTDCVVMRDPQTKRSRGFGFVTYSCVEEVDAAMCARPHKV

DGRVVEPKRAVSREDSVKPGAHLTVKKIFVGGIKEDTEEYNLRDYFEKYGKIETIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVVQKYHTINGHNCEVKK

ALSKQEMQSAGSQRGRGGGSGNFMGRGGNFGRGGNFG - UNI5036 - GGGYGGGGGGYDGYNEGGNFGGGNYGGGGNYNDFGNYSGQQQSNYGPMKG

GSFGGRSSGSPYGGGYGSGGGSGGYGSRRF

For any suggestions or comments, please send an email to unitrap@crg.es