Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000061082 (Plac1)
Chromosomal location
Chr X: 50423173 - 50467582 (-)
Description
placental specific protein 1 Gene [Source:MGI (curated);Acc:Plac1-001]
RefSeq_dna
NM_019538 
RefSeq_peptide
NP_062411.1 
UniGene
Mm.274842 Mm.405888 
MGI
MGI:1926287 
Uniprot/SWISSPROT
Q9JI83 
Uniprot/SPTREMBL
B1B0W9 
Human Ortholog
ENSG00000170965 (PLAC1)
Omim not available
UniTrap UNI28854
Vector Insertion
Chr X: 50451668 - 50467471
Public Clones not available
Private Clones OST17860 (lexicon) OST17847 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28838
Vector Insertion
Chr X: 50423172 - 50424066
Public Clones not available
Private Clones OST18381 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114843
Sequence
GAAGATTGAAGGCTAAGGGACCTGCCTCATCTTCTCGCTACCCCTTCCCTCGTGCTCCACACGGAGAGAACAGAACTAACAGAATTCTCAGCCCAAGATT

TCTTTTTTTAA - UNI28854 - CTGCCTTCAGCAGTGAGCACAAAGCCACGTTTCAAAGGAGACTGACAAATTATCCCCAGCTGCCAGAAGGAG AG

AATCCTTCCTGGACGCCTTCTTGTCTCCTGTGAGTCTTCACCTAACCTGCTGCAAGAATGAACCTTCGCAAGTTCCTGGGAGGCACTGTCTTAGTCGCCT

TCATGCTCTTCAGCTACTCGGAGCAAAACCAAGTGAATGTGCTGTGCTCGACAGATTGGTTCATGGTCACCGTTCACCCCTTCTTGCTGAATAATGATGT

GTATGTTCATTTTTACGAGGTGCACCTGGGCCTTGGTTGCCCTCCCAATCATGTTCACCCACATTTCTACCAGTTTCACTACCGCGTTACCGAATGTGGC

ATCCGCATCAAGGCTGTCTCTCCAGATGTCGTCATCTATAGCTCTGAGATTCACTATGCTTCCAAGGGCTCATCAACGAAATATGTGATTCCCGTGTCCT

GTGCTGCCCCTCGCCGGTCCCCTTGGCTCACTAAGCCCTACTCCGCGAAAGCACCTAGCAACAACATGGGTGCGACTCCGAAGAATGATACTTCCTACCA

CGTGTTCACCTTGCCAGAGCCTAGCGAACAACCCAACTGCAGCTGCCCACCTTATGTCTACAATCAAAAGAGCATGTAAACCCTCCATCATGGGACAGAG

TCTTTGGAGGTCCTTCTTGTGTAGTCATCTGACTGTGCAAATGTTTCTGGGGACTAGTGTGTTCACTCAGATGATCTGAGGAAACCCATATAGTGCCCAG

ATGTAAGGGCTTCTGAAAATTCTGTTTCTAAAAATGAATATATAGCATTTTCTACTGTCAGCCAAATAGATGCCATGATAGCTCTTTTAGGGGAATTTTG

GAAAGGGTCAATTCATATATAGCTGATTGTAACTTTTTTTTTTACTATTTTTGTATCTTTTAAAACAATAATAAAATTCTGATTGGCAATAAA
Translation
 - UNI28854 -  MNLRKFLGGTVLVAFMLFSYSEQNQVNVLCSTDWFMVTVHPFLLNNDVYVHFYEVHLGLGCPPNHVHPHFYQFHYRVTECGIRIK

AVSPDVVIYSSEIHYASKGSSTKYVIPVSCAAPRRSPWLTKPYSAKAPSNNMGATPKNDTSYHVFTLPEPSEQPNCSCPPYVYNQKSM
Transcript ENSMUST00000074861
Sequence
GAAGATTGAAGGCTAAGGGACCTGCCTCATCTTCTCGCTACCCCTTCCCTCGTGCTCCACACGGAGAGAACAGAACTAACAGAATTCTCAGCCCAAGATT

TCTTTTTTTAA - UNI28854 - CTGCCTTCAGCAGTGAGCACAAAGCCACGTTTCAAAGGAGACTGACAAATTATCCCCAGCTGCCAGAAGGAG - 

UNI28838 - AATCCTTCCTGGACGCCTTCTTGTCTCCTGTGAGTCTTCACCTAACCTGCTGCAAGAATGAACCTTCGCAAGTTCCTGGGAGGCACTGT

CTTAGTCGCCTTCATGCTCTTCAGCTACTCGGAGCAAAACCAAGTGAATGTGCTGTGCTCGACAGATTGGTTCATGGTCACCGTTCACCCCTTCTTGCTG

AATAATGATGTGTATGTTCATTTTTACGAGGTGCACCTGGGCCTTGGTTGCCCTCCCAATCATGTTCACCCACATTTCTACCAGTTTCACTACCGCGTTA

CCGAATGTGGCATCCGCATCAAGGCTGTCTCTCCAGATGTCGTCATCTATAGCTCTGAGATTCACTATGCTTCCAAGGGCTCATCAACGAAATATGTGAT

TCCCGTGTCCTGTGCTGCCCCTCGCCGGTCCCCTTGGCTCACTAAGCCCTACTCCGCGAAAGCACCTAGCAACAACATGGGTGCGACTCCGAAGAATGAT

ACTTCCTACCACGTGTTCACCTTGCCAGAGCCTAGCGAACAACCCAACTGCAGCTGCCCACCTTATGTCTACAATCAAAAGAGCATGTAAACCCTCCATC

ATGGGACAGAGTCTTTGGAGGTCCTTCTTGTGTAGTCATCTGACTGTGCAAATGTTTCTGGGGACTAGTGTGTTCACTCAGATGATCTGAGGAAACCCAT

ATAGTGCCCAGATGTAAGGGCTTCTGAAAATTCTGTTTCTAAAAATGAATATATAGCATTTTCTACTGTCAGCCAAATAGATGCCATGATAGCTCTTTTA

GGGGAATTTTGGAAAGGGTCAATTCATATATAGCTGATTGTAACTTTTTTTTTTACTATTTTTGTATCTTTTAAAACAATAATAAAATTCTGATTGGC
Translation
 - UNI28854 -  - UNI28838 - MNLRKFLGGTVLVAFMLFSYSEQNQVNVLCSTDWFMVTVHPFLLNNDVYVHFYEVHLGLGCPPNHVHPHFYQ

FHYRVTECGIRIKAVSPDVVIYSSEIHYASKGSSTKYVIPVSCAAPRRSPWLTKPYSAKAPSNNMGATPKNDTSYHVFTLPEPSEQPNCSCPPYVYNQKS

M

For any suggestions or comments, please send an email to unitrap@crg.es