Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000061353 (Cxcl12)
Chromosomal location
Chr 6: 117118553 - 117131385 (+)
Description
chemokine (C-X-C motif) ligand 12 Gene [Source:MGI (curated);Acc:Cxcl12-003]
RefSeq_dna
NM_021704 NM_001012477 NM_013655 
RefSeq_peptide
NP_068350.1 NP_001012495.1 NP_038683.1 
UniGene
Mm.303231 Mm.407920 
MGI
MGI:103556 
Uniprot/SWISSPROT
P40224 
Uniprot/SPTREMBL
Q4FJL5 
Human Ortholog
ENSG00000107562 (CXCL12)
Omim not available
UniTrap UNI12774
Vector Insertion
Chr 6: 117126103 - 117131385
Public Clones F023B07 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000112866
Sequence
GGTTTTCGCCTCTAAAGCGCCCAGCGCTCGCCTCCCGCTGCCGCACTTTCACTCTCGGTCCACCTCGGTGTCCTCTTGCTGTCCAGCTCTGCAGCCTCCG

GCGCGCCCTCCCGCCCACGCCATGGACGCCAAGGTCGTCGCCGTGCTGGCCCTGGTGCTGGCCGCGCTCTGCATCAGTGACG GTAAACCAGTCAGCCTG

AGCTACCGATGCCCCTGCCGGTTCTTCGAGAGCCACATCGCCAGAGCCAACGTCAAGCATCTGAAAATCCTCAACACTCCAAACTGTGCCCTTCAGATTG

T TGCACGGCTGAAGAACAACAACAGACAAGTGTGCATTGACCCGAAATTAAAGTGGATCCAAGAGTACCTGGAGAAAGCTTTAAACAAGTAAGCACAAC

AGCCCAAAGGACTTTCCAGTAGACCCCCGAGGAAGGCTGACATCCGTGGGAGATGCAAGGGCAGTGGTGGGGAGGAGGGCCTGAACCCTGGCCAGGATGG

CCGGCGGGACAGCACTGACTGGGGTCATGCTAAGGTTTGCCAGCATAAAGACACTCCGCCATAGCATATGGTACGATATTGCAGCTTATATTCATCCCTG

CCCTCGCCCGTGCACAATGGAGCTTTTATAACTGGGGTTTTTCTAAGGAATTGTATTACCCTAACCAGTTAGCTTCATCCCCATTCTCCTCATCCTCATC

TTCATTTTAAAAAGCAGTGATTACTTCAAGGGCTGTATTCAGTTTGCTTTGGAGCTTCTCTTTGCCCTGGGGCCTCTGGGCACAGTTATAGACGGTGGCT

TTGCAGGGAGCCCTAGAGAGAAACCTTCCACCAGAGCAGAGTCCGAGGAACGCTGCAGGGCTTGTCCTGCAGGGGGCGCTCCTCGACAGATGCCTTGTCC

TGAGTCAACACAAGATCCGGCAGAGGGAGGCTCCTTTATCCAGTTCAGTGCCAGGGTCGGGAAGCTTCCTTTAGAAGTGATCCCTGAAGCTGTGCTCAGA

GACCCTTTCCTAGCCGTTCCTGCTCTCTGCTTGCCTCCAAACGCATGCTTCATCTGACTTCCGCTTCTCACCTCTGTAGCCTGACGGACCAATGCTGCAA

TGGAAGGGAGGAGAGTGATGTGGGGTGCCCCCTCCCTCTCTTCCCTTTGCTTTCCTCTCACTTGGGCCCTTTGTGAGATTTTTCTTTGGCCTCCTGTAGA

ATGGAGCCAGACCATCCTGGATAATGTGAGAACATGCCTAGATTTACCCACAAAACACAAGTCTGAGAATTAATCATAAACGGAAGTTTAAATGAGGATT

TGGACTTTGGTAATTGTCCCTGAGTCCTATATATTTCAACAGTGGCTCTATGGGCTCTGATCGAATATCAGTGATGAAAATAATAATAATAATAATAATA

ACGAATAAGCCAGAATCTTGCCATGAAGCCACAGTGGGGATTCTGGGTTCCAATCAGAAATGGAGACAAGATAAAACTTGCATACATTCTTATGATCACA

GACGGCCCTGGTGGTTTTTGGTAACTATTTACAAGGCATTTTTTTACATATATTTTTGTGCACTTTTTATGTTTCTTTGGAAGACAAATGTATTTCAGAA

TATATTTGTAGTCAATTCATATATTTGAAGTGGAGCCATAGTAATGCCAGTAGATATCTCTATGATCTTGAGCTACTGGCAACTTGTAAAGAAATATATA

TGACATATAAATGTATTGTAGCTTTCCGGTGTCAGCCACGGTGTATTTTTCCACTTGGAATGAAATTGTATCAACTGTGACATTATATGCACTAGCAATA

AAATGCTAATTGTTTCATGCTGTAAACCTCCTACCGTATGTGGGAATTTATTTACCTGAAATAAAATCTACTAGTTGTTA
Translation
MDAKVVAVLALVLAALCISDG GKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIV VARLKNNNRQVCIDPKLKWIQEYLEKALNK
Transcript ENSMUST00000073043
Sequence
CGCCTCCCGCTGCCGCACTTTCACTCTCGGTCCACCTCGGTGTCCTCTTGCTGTCCAGCTCTGCAGCCTCCGGCGCGCCCTCCCGCCCACGCCATGGACG

CCAAGGTCGTCGCCGTGCTGGCCCTGGTGCTGGCCGCGCTCTGCATCAGTGACG GTAAACCAGTCAGCCTGAGCTACCGATGCCCCTGCCGGTTCTTCG

AGAGCCACATCGCCAGAGCCAACGTCAAGCATCTGAAAATCCTCAACACTCCAAACTGTGCCCTTCAGATTGT TGCACGGCTGAAGAACAACAACAGAC

AAGTGTGCATTGACCCGAAATTAAAGTGGATCCAAGAGTACCTGGAGAAAGCTTTAAACAA - UNI12774 - GGGGCGCAGAGAAGAAAAAGTGGGG

AAAAAAGAAAAGATAGGAAAAAAGAAGCGACAGAAGAAGAGAAAGGCTGCCCAGAAAAGGAAAAACTAGTTCCCCGCTTCCTGCCGATGGACCGCAGTGC

GCTCTGCTCTGGCGCTTTGTAACTCGCTCCTCCCTCTTCGGGGGCAGACCCCACACTCCGGGCAGGTGCTCAAACCTGACGGTAAACTCTTCCCTCTTCG

GGGGCAGACCCCATACCCCGGGGCGGGTGCTTAGGCTTTCCTGCCCTGGTGGCCACACCAGCTGCTGTATTTATGTGCTTCATAAGGCCCTGCTCTGTCT

GCTAAAGCTATGAAGAAAGATGTGCAGAGACTGGGGTGGAGACTAAGCCAAAGAGGAGCTGCCTAGCCTGGCAGCATTGCCCCGAGCTGAGCCCCCTTGG

CCAGGACTTCACAAGGCTCACACCTACAATCCCATGAAGGCCAGGGTGGTCTGCTTAGCCAGGAAAGGGCAAGTGCCTTCCCCTCGGCCACACTGCCCCT

TGTGGCCTTCTCGGGACATGTGGTAACTGACTTGCTCTCAGGCCCACCCGCAGCTTTTCCAAATACCTGCAGCCTTCAGCCCTGCTGCCCTGCCTGTGGG

AGCAGCTTTGACTCCAGTCCAGAAGGGTTTCTGCAGACTGTGTTGGGTGAGACGCAGAAAGGATGAAATCTCAGAACACATGTCAGCTGCTTCTCAGGAA

ATCTTTTCTTTGGACAATTCACTTTAGAGTCTTTAAACGGGTCTCTCGTGGGGAGGATAGATGTGCTCTGGAACTTTCTGAAGGACCAGCAGCTTCAGGG

ACTCTTAGTCTGTCCTTCCCCACTTTTGGTCCCAACATCCCTGGGATGGTGTGCTGTCTGGGCACCACGGTCTCCATCCTCACTCCTGAGAGATTTCTGC

CTTCTGTGAGTTGGGTTAAAGCTCTGGAATTATCTACTATCCCAATCCACTACCCTCACCTGGCAATATTTGTCTGTTTTTGTTTGTTTGTTTGTTTGTT

TTTGTCTTTTGCCAGTTTGAATTAGAAGGCAAGGCTCTGATTTTAGTAGTGTTTTGGAAAAGGACTTTTTTCTTCACCTTCCTCTTTGCCTCATGTGTAC

ACACACACACACATCTTGTACCCCAGACCTCTGGGTATAATTTTCATAATTGGTGCAGAAAGAAGAAATGATCTGAAGATGTGTTAAATGGATTGCAGGG

GAAGGAAGGCCCAGGGCCCTGTGTGTCATGCCCTCTTGGGTTCCTAAGTTCTATGTTCCTTAGAGGTTCTAGCATTAAACAGATAAAGCCCTTCATGGTC

CTGGCTGAGGAAGAGTCTTGCTAGGGGGATTCAGGGAAGACCCGTGTTACCAGCTCTTACCCTTTATCTGGACAGCTCTCCTACCCTGTATCTTCTCCTC

AGATCTGAGGATAGCAGGCTGGACTATTGGTGGGCACCTTTCAAGCCCAGGGCTACTGTTTGTCCTGTGGCAGCCGGCTACAGTCTCGTCTGAGTGGCCT

CATCTGGACCCTTCCTGTTATTAATAAAACGCTTCTGGAGGCCAGATCTGTGCTCAAGCCATAGTTCTGCTTAGAAAGGGATGCCCCACCCTTACCGGAC

ACTGGGAAGAACTGTTGGCCCCTAGAAACCAAAGGCCAAACTGAGGCTGCCCTGAGTTGGAAGACCACTTTCTGAAATGCCCATGGACTCTGCCTCCCAA

CCATTCGTCTCTCACTCCTAGCAGAGCTGTCTGTGCAGACTGTTTCTTAGGAGGCACAGCAAGCTCCAGGGAACCCTCTGTGCTTATGAAGCTCGTCTGG

TGGGCAACCCCAGCCCACTGGACAGAGTCCTCATGGAAATGCCTGGGAAGCTGATTTCATCTAAGGATGGGTTGAAGTAGGATGTGCTCCTGCGACTTCT

CAGGCAGGTGAGAGGGGTAGTCCTTACACTGTCTAGCATAAACGCCTTCCGGAAGGACCTGCAGCTCCAGAGACCACCTCCTGAGCACCAAGACCTCTTC

TGGTGGTGTGGAACCAGCCAAGAGATTTCAAGGAAGAGTGATTATTTGATGAATGCTATGGGAATGGCCTCTTCTCTTGGAGTTCTGAGGCCTGGGGATG

CCCAGGAACACTGGGCACCTGCTGCTGTTAGGGCCAATGCATAGTCTCAGCACCGGTGTCCTAAGGTTAAGGCGGTGCGCCTTGTCATGTGCTCCTTGTA

CCATGCCATCTGTGCCAGTGTGTGTCTGCCTCACCCTGTGCTTGACATGTTCACCCATCTTCTCTGCTTCCCGCCACCATCCAGATCCTCAGCGGCCGCC

CCGGCTGTGCCCTTCCCTGCTCTCCCGCTCTCTCAGGCCTCGGAAGGAAGATCGGTGGCTGCGAGCTGAACTAAGGAGTAGGGCCTGTGGCTCAGCGCTA

GGCCACGCACGCAGCATCCCAGGCATGTGGTGAGAAACTGCCTTAATGTGTCTCCTCTGTTCTTGTCAACAGGAGGCTCAAGATGTGAGAGGTGTGAGTC

AGACGCCCGAGGAACTTACAGGAGGAGCCTAGGTCTGAAGTCAGTGTTAGGGAAGGGCCCATAGCCACTTCCTCTGCTCCTGAGCAGGGCTGAAGCCGTT

TGCAAGGGACTTGCTTTGCACAGTTTTGCTGTACTTTCACATTTTATTATGTAGCAAGATACATGGTGATTTTTTTTTTTTTCATTTAGCCTGATTTTCC

AACGTCATTGGTGACAGGCCAAGGCCACTATGTTATTTCCTTTGTTCTGGTATCCTTCCCTTGGAGGACCTTCTCTGAGTAGTGGCTCCCCAGGTTTGTC

CTTTGAGCTGAGGCAGGAGGCTCACCCATTCTTCTGAATAGGAACTGGGTGTTCCCACCCCCCAAGGACTGCAGGGCTTTCCCAAGCTGAGGCAGGAACG

TGAGGCCAGGGAAGAGTGAGCTTCACCCTCATCCCACGCTGTCCTCCTCAACCCACCATGCTCATCATTCTGTCTCATCCATCCATCCATCCATCCATTC

ATCGCCATGTGTCCGCAAGACTGTCTCCATGACCCTGAAAAAGGACTCTCGAGATGAAATCCTTTATTCAAATGGGACAGCAAGAAGGAAAAGCCAATGT

CTGGTGTCTCTCCCCCCGCCCCTACCCTGCGCGCATCTATGTCTTGTTTGGAATATTGTCTCTTCAACCCCCTGTTCATGTCCTTCTCACTCATGATCGA

TGTCTTGTCTGTGCACTGTCTCTAACCCAAATGCAAAGGCTGAGTGTGAGGTGATGGCCCCGAGGTCCAGGTTGTAGTCATGGAAAGAGCCCTGCTGTCT

CCCTTCTCAGGGGGCCCATTTTAGACACACAAAGCCCAAAGAAAGGTGGTTTGCAACAGTGCTTAGCTCGAGCCTCCATATTTCCATAACTGTTAGCTTA

AAACTGTGGGGTTTTACCTTCCTGGAACCAAATGCATTCTTCTGTTGAGGAGTAACAGGTCTCAATTCTTTTCAATTAATTTTAAAAGTCAATCACTAAG

AGCATCGGCTTTGGGCCCTGATGGGCAGGCATTTCCCTGGAAAGGGGGTGAACTACCTACCTCTCCTCAAGACAGCCGAAGGGTGGGATTGGTGCCGCTC

TGGGAAGCGTGGCCCCAGGAGTTTTGTCCTCTGCAGTTTTTAATGCAAGTTCACTGCCACTTTGACAAAAGCCCAATTAGAAGCCAGTCTCTAGTTCCTT

AAACAAAACAGACAGAGTAAGGAAAGGAAGGAGGGTGGCAGCCAGCTGGCTGGACACTCGAGAAAGACGGGGAAGTAAGCTACAGAAAGATAGTCTTCAA

AAACAGGTGTTTGAGAGTGAATACTCTGTAGAATTGTTAGTGGGGTGTGTGTGGTGGTGGTGGGGGGATTTCTACAAAATAGTCCTTTAAGTTGAGTTTA

CAGCAGATGAAAAATCCAACCAGCAAAATTTTGATCAAATTTGAACAAAAACCCAAAAACCTAAAACTGTTGAGCAGGTTGCGATGAGGAGCACAGGGCT

AGCTGCAGAGCTGGATCCTCAGGAGGATAGCGAATTATTTTCAACCCTGGAATAGAAACCACACACTGGCTTGCTGTGCACCAGCCACTTTGCATCTAAT

CCAAGCTTTGAAGGGTGTTGCTTGGGAGGAAACAAATACAGCCTTCCATCTTCACTCCAGTTAGGGATCCTTTCAAAGTCTCCTTCACAGTGAGGAAAAA

GAGAAGGGTAGAAACTTTAGGGAGCCGGATTTGTGTATCAATTCCTCCGCTGACAGTCAGTTTCTAGATGGAGACAGCCTGCTTAAAGCAAATCCGAATT

TAAATAGGACATTTACATCGGAAAAGTCTCTCCCTACCTTAATCCCCCATTCTCTTGCTTTCAAAATACAAGCACAGCAGTCCTTGAATGGCTGTTGACC

CAGGGCACCTAGCTGTCCCTGCTGGTCCTGGGGCTGCCAGAATTCCCTTGGGCGCCAAGCAACCTGCCAGGTAGCCAGTCCCTCTGTTACAAGCCTTTGC

ATCTGGATAGGGAAAGGGGTGGAGACATACAGTCTGCTTTGTGTTGAAACCCAGATTTGTACCCTGTGTTTATACACTGCTGCTGGCTCCCGAGGACAGT

GGGACTTTAGCAAGGAAGTGCAGCCGAGGGGTAAAGAGCCCTCTGGTTCATTGCCTGATCGGCTTTGAGAGAGGGTTTGGAGGGCAAGGGGCTGCATTCC

TCTGAGGGACTTGGCCTGAGGCCTTTCGGGCCTCTCCAGTGGGTTCTGTTTATCCTCTCATGGGTGATTATCTCAGTGGTGTCACCAGGGGCTTCCTCCC

AGAAGTCAGTCATCCCCAGGCCGTGCACCCTTTTCAGCTGGATGAGAGCCAGGGATGCATTCTCTCCAAACAGCTACCCTGGCCCATTTTAAGGTAATCT

CATTCTTCAAAATGTTCCATAGAATCCTCCAAATTCCCCCAGCAGACTTCTACCCTCGCCAAGTTCCCAAAACCCACTCAGCAAAGTTGCCAACCTCGAC

GGGCTAGCAGTGTCTAAGCAGCGATGGGTTCAGTGTTGTGTGTGGTGAATACTGTATTTTGTTTCAGTTCTGTCTCCCAGATAATGTGAAAACGGTCCAG

GAGAAGGCAGCTTCCTATATGCAGCGTGTGCTTTCTTATTCTTATTTTTAATATATGACAGTTATTTGAGAAGCCATTTCTACTTTGAAGTCATTATCGA

TGAAAGTGATGTATCTTCACCTACCATTTTCCTAATAAAGTTCTGTATTCAAATATA
Translation
MDAKVVAVLALVLAALCISDG GKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIV VARLKNNNRQVCIDPKLKWIQEYLEKALNK - UNI1

2774 - KGRREEKVGKKEKIGKKKRQKKRKAAQKRKN
Transcript ENSMUST00000112871
Sequence
GCCGCACTTTCACTCTCGGTCCACCTCGGTGTCCTCTTGCTGTCCAGCTCTGCAGCCTCCGGCGCGCCCTCCCGCCCACGCCATGGACGCCAAGGTCGTC

GCCGTGCTGGCCCTGGTGCTGGCCGCGCTCTGCATCAGTGACG GTAAACCAGTCAGCCTGAGCTACCGATGCCCCTGCCGGTTCTTCGAGAGCCACATC

GCCAGAGCCAACGTCAAGCATCTGAAAATCCTCAACACTCCAAACTGTGCCCTTCAGATTGT TGCACGGCTGAAGAACAACAACAGACAAGTGTGCATT

GACCCGAAATTAAAGTGGATCCAAGAGTACCTGGAGAAAGCTTTAAACAA - UNI12774 - GAGGCTCAAGATGTGAGAGGTGTGAGTCAGACGCCC

GAGGAACTTACAGGAGGAGCCTAGGTCTGAAGTCAGTGTTAGGGAAGGGCCCATAGCCACTTCCTCTGCTCCTGAGCAGGGCTGAAGCCGTTTGCAAGGG

ACTTGCTTTGCACAGTTTTGCTGTACTTTCACATTTTATTATGTAGCAAGATACATGGTGATTTTTTTTTTTTTCATTTAGCCTGATTTTCCAACGTCAT

TGGTGACAGGCCAAGGCCACTATGTTATTTCCTTTGTTCTGGTATCCTTCCCTTGGAGGACCTTCTCTGAGTAGTGGCTCCCCAGGTTTGTCCTTTGAGC

TGAGGCAGGAGGCTCACCCATTCTTCTGAATAGGAACTGGGTGTTCCCACCCCCCAAGGACTGCAGGGCTTTCCCAAGCTGAGGCAGGAACGTGAGGCCA

GGGAAGAGTGAGCTTCACCCTCATCCCACGCTGTCCTCCTCAACCCACCATGCTCATCATTCTGTCTCATCCATCCATCCATCCATCCATTCATCGCCAT

GTGTCCGCAAGACTGTCTCCATGACCCTGAAAAAGGACTCTCGAGATGAAATCCTTTATTCAAATGGGACAGCAAGAAGGAAAAGCCAATGTCTGGTGTC

TCTCCCCCCGCCCCTACCCTGCGCGCATCTATGTCTTGTTTGGAATATTGTCTCTTCAACCCCCTGTTCATGTCCTTCTCACTCATGATCGATGTCTTGT

CTGTGCACTGTCTCTAACCCAAATGCAAAGGCTGAGTGTGAGGTGATGGCCCCGAGGTCCAGGTTGTAGTCATGGAAAGAGCCCTGCTGTCTCCCTTCTC

AGGGGGCCCATTTTAGACACACAAAGCCCAAAGAAAGGTGGTTTGCAACAGTGCTTAGCTCGAGCCTCCATATTTCCATAACTGTTAGCTTAAAACTGTG

GGGTTTTACCTTCCTGGAACCAAATGCATTCTTCTGTTGAGGAGTAACAGGTCTCAATTCTTTTCAATTAATTTTAAAAGTCAATCACTAAGAGCATCGG

CTTTGGGCCCTGATGGGCAGGCATTTCCCTGGAAAGGGGGTGAACTACCTACCTCTCCTCAAGACAGCCGAAGGGTGGGATTGGTGCCGCTCTGGGAAGC

GTGGCCCCAGGAGTTTTGTCCTCTGCAGTTTTTAATGCAAGTTCACTGCCACTTTGACAAAAGCCCAATTAGAAGCCAGTCTCTAGTTCCTTAAACAAAA

CAGACAGAGTAAGGAAAGGAAGGAGGGTGGCAGCCAGCTGGCTGGACACTCGAGAAAGACGGGGAAGTAAGCTACAGAAAGATAGTCTTCAAAAACAGGT

GTTTGAGAGTGAATACTCTGTAGAATTGTTAGTGGGGTGTGTGTGGTGGTGGTGGGGGGATTTCTACAAAATAGTCCTTTAAGTTGAGTTTACAGCAGAT

GAAAAATCCAACCAGCAAAATTTTGATCAAATTTGAACAAAAACCCAAAAACCTAAAACTGTTGAGCAGGTTGCGATGAGGAGCACAGGGCTAGCTGCAG

AGCTGGATCCTCAGGAGGATAGCGAATTATTTTCAACCCTGGAATAGAAACCACACACTGGCTTGCTGTGCACCAGCCACTTTGCATCTAATCCAAGCTT

TGAAGGGTGTTGCTTGGGAGGAAACAAATACAGCCTTCCATCTTCACTCCAGTTAGGGATCCTTTCAAAGTCTCCTTCACAGTGAGGAAAAAGAGAAGGG

TAGAAACTTTAGGGAGCCGGATTTGTGTATCAATTCCTCCGCTGACAGTCAGTTTCTAGATGGAGACAGCCTGCTTAAAGCAAATCCGAATTTAAATAGG

ACATTTACATCGGAAAAGTCTCTCCCTACCTTAATCCCCCATTCTCTTGCTTTCAAAATACAAGCACAGCAGTCCTTGAATGGCTGTTGACCCAGGGCAC

CTAGCTGTCCCTGCTGGTCCTGGGGCTGCCAGAATTCCCTTGGGCGCCAAGCAACCTGCCAGGTAGCCAGTCCCTCTGTTACAAGCCTTTGCATCTGGAT

AGGGAAAGGGGTGGAGACATACAGTCTGCTTTGTGTTGAAACCCAGATTTGTACCCTGTGTTTATACACTGCTGCTGGCTCCCGAGGACAGTGGGACTTT

AGCAAGGAAGTGCAGCCGAGGGGTAAAGAGCCCTCTGGTTCATTGCCTGATCGGCTTTGAGAGAGGGTTTGGAGGGCAAGGGGCTGCATTCCTCTGAGGG

ACTTGGCCTGAGGCCTTTCGGGCCTCTCCAGTGGGTTCTGTTTATCCTCTCATGGGTGATTATCTCAGTGGTGTCACCAGGGGCTTCCTCCCAGAAGTCA

GTCATCCCCAGGCCGTGCACCCTTTTCAGCTGGATGAGAGCCAGGGATGCATTCTCTCCAAACAGCTACCCTGGCCCATTTTAAGGTAATCTCATTCTTC

AAAATGTTCCATAGAATCCTCCAAATTCCCCCAGCAGACTTCTACCCTCGCCAAGTTCCCAAAACCCACTCAGCAAAGTTGCCAACCTCGACGGGCTAGC

AGTGTCTAAGCAGCGATGGGTTCAGTGTTGTGTGTGGTGAATACTGTATTTTGTTTCAGTTCTGTCTCCCAGATAATGTGAAAACGGTCCAGGAGAAGGC

AGCTTCCTATATGCAGCGTGTGCTTTCTTATTCTTATTTTTAATATATGACAGTTATTTGAGAAGCCATTTCTACTTTGAAGTCATTATCGATGAAAGTG

ATGTATCTTCACCTACCATTTTCCTAATAAAGTTCTGTATTCAAATAT
Translation
MDAKVVAVLALVLAALCISDG GKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIV VARLKNNNRQVCIDPKLKWIQEYLEKALNK - UNI1

2774 - KRLKM

For any suggestions or comments, please send an email to unitrap@crg.es