Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000061374 (Fiz1)
Chromosomal location
Chr 7: 4958662 - 4966254 (-)
Description
Flt3 interacting zinc finger protein 1 Gene [Source:MGI Symbol;Acc:MGI:1344336]
RefSeq_peptide
NP_035943.3 NP_001103798.1 NP_001103800.1 NP_001103799.1 
UniGene
Mm.38911 
MGI
MGI:1344336 
Uniprot/SWISSPROT
Q9WTJ4 
Uniprot/SPTREMBL
Q3TRV0 Q571H7 
Human Ortholog
ENSG00000179943 (FIZ1)
Omim not available
UniTrap UNI513
Vector Insertion
Chr 7: 4964625 - 4966226
Public Clones (sanger) CF0714 (sanger) E077B05 (ggtc) E115G04 (ggtc) E062H01 (ggtc)
P149F06 (ggtc) CMHD-GT_366E4-3 (cmhd) FHCRC-GT-S23-6B1 (fhcrc) IST14733G2 (tigm)
IST14771A2 (tigm)
Private Clones OST438029 (lexicon) OST369785 (lexicon) OST281636 (lexicon) OST247032 (lexicon)
OST217441 (lexicon) OST129426 (lexicon) OST113021 (lexicon) OST65624 (lexicon)
OST62484 (lexicon) OST46148 (lexicon) OST31199 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8117
Vector Insertion
Chr 7: 4960808 - 4964279
Public Clones RRG188 (baygenomics) RRG347 (baygenomics) (ggtc) D060F12 (ggtc)
IST13201G3 (tigm) IST10913G6 (tigm)
Private Clones OST258294 (lexicon)
Severity of mutation (?) Insertion after 21% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000077385
Sequence
CCCAAAATGTCGGCGCCCAGAGGGAGGT - UNI513 - AGAAAGCCCCAAGCCACCTCCGGACCTTCCGTCATGGAAGACTCCTCGCTGCCTGTGGTT

CCTGCCCCCATCGCTGCTCCAGGACCAGCACCATCTGCCACTGCGCCTCGGGTCCCCTTTCACTGTAGCGAATGTGGCAAGAGTTTCCGTTACCGATCAG

ACCTGAGGCGCCACTTTGCTCGACACACGGCTCTCAAGCCCCACGCATGTCCTCGATGCGGTAAGGGCTTCAAGCATAGCTTCAACTTGGCTAACCACCT

GCGCTCACACACTGGTGAACGACCCTACCGATGCTCTGCCTGCCCTAAGGGATTCCGAGACTCCACTGGCCTGCTGCACCACCAG - UNI8117 - GT

GGTCCACACTGGTGAAAAGCCCTACTGCTGTTTGGTCTGTGAGCTCCGCTTCTCCTCTCGCTCCAGCCTGGGCCGCCATCTCAAGCGGCAGCACCGGGGC

ACACTTCCCTCTCCCCTGCAGCCTAGCCCCGGCCTGCCTCCCCTGAGCTCCCCCTGCTCAGTATGTTGCAACGTGGGTCCCTGTTCGGTTTGTGGAGGTG

GAGGGTCCAGTGGAGGAGAGGGCCTGGAGGGAGCAGGAGCAACCAGCTGGGGACTGGCAGAGGCTGCAGCAGCCGCGGCAGCCTCGCTGCCCCCATTTGC

ATGCGGTGCCTGTGCCAGGCGTTTTGACCATGGCCGGGAGCTTGCAGCCCACTGGGCCGCACACACCGATGTGAAGCCATTCAAGTGCCCTCGCTGTGAG

CGCGACTTCAACGCACCTGCGCTGCTGGAACGCCACAAGCTCACTCATGACCTGCAGGGGAGCAATGCACCTCCAACGCAGGTTTGGGCCTCGGGTGGGG

GTCCGGAGGTGGCAGGAGAGGGAGATGCCTCAGAGGTGGGGGCCGCCCCCCAGACTTGGGACGCCGGGCTGCTCCTGAGCCCTACCGGGGCAGGCGTGCC

CAAGCTGGAGGCATTGCTCCCGGGGGACGAGGGCTCTGGGAATGACCAGGCTCCGGCTGCAGCAGCCGAAGCATCTTCGGAAGACACACTGTACCAGTGC

GACTGCGGGACCTTCTTCGCATCTGCCCCGGCTTTGGCCAGCCATTTAGAGGCTCACTCAGGCCCAGCCACTTATGGCTGTGGCCACTGCGGGGCGCTGT

ACGCAGCGCTGGCTGCCCTGGAGGAGCATCGGCGTGCAAGCCATGGTGAGGGTAGCGGGGAGGCAGCCCCCGATGGTGAGGGCAATCAGGCGGCTGGCGG

GCCGGGACCCGGCTCCTCCAGCCGTAGCAAGAAGATCTTTGGCTGTTCCGAATGTGAGAAGCTGTTCCGTTCACCTCGAGACCTGGAAAGGCATGTGTTG

GTCCATACCGGGGAAAAGCCGTTCCCGTGCCTGGAGTGTGGCAAGTTCTTCCGCCACGAGTGCTACCTCAAGCGTCACCGGCTGCTGCATGGCACAGAGC

GGCCCTTCCCCTGCCACATCTGTGGCAAGGGCTTCATCACGCTTAGCAACCTCTCCAGGCATCTGAAGCTACACAGGGGCATGGACTGAATAACCAGGAC

ACCCCTGCCCACTGAGTCCAGAGCCAGACCGTAAGACAAGCCAGGCCCCTGCCTGGAAAAATGGTGCCACCCAGAACCCACAGTGAAACATCCTTCAGCA

AAGGGGGTCCAAGAACATAATTGTTGGGGAATTTCTCTCTGAAACCTACAGAGACTATTCACTTTGAGACCCCTGGAATGTGGCATGTTCAAATCAACTG

GCCTCCAAGACTGGGTACATAGTAATGAAAAACGGGTCTCCACTAACATCTCTCTGAAGATAACATGTAGGCACCCCCATGATTTTAACCACCCTGTGAG

CCAGCATTCCAGATCCTTCATCTAGAGAATGGGGGTGGGGCAATATCTTAGACTCCTCCAGGAACCCCTCAAATGACACCTGCCAGCCACTGGTGACCCC

AGAAAATGAGTATAACCGAAATCTGCCTTCCGCCAATTTTGCTTCCTGTACTGAAAGAAGATCAGGGTAGATGCCCCCCACCTTCAGTTAACCCACTCTC

AGATTAGGTCTCCCTTACTGCAGAATGGTCTGACCCTACTGATCTTCCCCCATCCTGAACACTAGATTAGACTGGCCCTTTAGGTTGGACTAACCCAGAT

GCACATACTCCTATCCACTTGGAATGGGCTGGTGTCTGGAATGGTTGTGGCCTAATCCCACTCTCCTTAGAGTAATAGGGCAGACATTCCCTTATGCTGT

AGAGCACAGTCCTTTGACCACGATTTCCCAATCCTGTGACCTGGTGGAGGTGGTAGACATTGAGGCTTTCCCTACCCCTTGACTTGTAGTACTTTGGTCT

TTCCATCACTACAACTTGACTCTTTGTTCCAATGTCCCAAGGGGATATGGGAACTTGGCCAGGGGTTTCTCTCCTGTGAGCCTCAACCTGACCCCTGACC

CCTCTCCCCAATGTCTCTGGGACTCCAATAAACCTCATTCAGTC
Translation
 - UNI513 - MEDSSLPVVPAPIAAPGPAPSATAPRVPFHCSECGKSFRYRSDLRRHFARHTALKPHACPRCGKGFKHSFNLANHLRSHTGERPYRCS

ACPKGFRDSTGLLHHQ - UNI8117 - VVHTGEKPYCCLVCELRFSSRSSLGRHLKRQHRGTLPSPLQPSPGLPPLSSPCSVCCNVGPCSVCGGGGSS

GGEGLEGAGATSWGLAEAAAAAAASLPPFACGACARRFDHGRELAAHWAAHTDVKPFKCPRCERDFNAPALLERHKLTHDLQGSNAPPTQVWASGGGPEV

AGEGDASEVGAAPQTWDAGLLLSPTGAGVPKLEALLPGDEGSGNDQAPAAAAEASSEDTLYQCDCGTFFASAPALASHLEAHSGPATYGCGHCGALYAAL

AALEEHRRASHGEGSGEAAPDGEGNQAAGGPGPGSSSRSKKIFGCSECEKLFRSPRDLERHVLVHTGEKPFPCLECGKFFRHECYLKRHRLLHGTERPFP

CHICGKGFITLSNLSRHLKLHRGMD

For any suggestions or comments, please send an email to unitrap@crg.es