Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000061393 (Acvr2b)
Chromosomal location
Chr 9: 119311562 - 119342619 (+)
Description
activin receptor IIB Gene [Source:MGI Symbol;Acc:MGI:87912]
RefSeq_dna
NM_007397 
RefSeq_peptide
NP_031423.1 
MGI
MGI:87912 
Uniprot/SWISSPROT
P27040 
Uniprot/SPTREMBL
Q3KQI1 
Human Ortholog
ENSG00000114739 (ACVR2B)
Omim 602730 - ACTIVIN A RECEPTOR, TYPE IIB  
UniTrap UNI22279
Vector Insertion
Chr 9: 119311716 - 119336572
Public Clones (sanger) E323B07 (ggtc) E325E06 (ggtc)
Private Clones OST301791 (lexicon) OST215486 (lexicon)
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27874
Vector Insertion
Chr 9: 119336781 - 119337084
Public Clones not available
Private Clones OST45392 (lexicon)
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21431
Vector Insertion
Chr 9: 119341962 - 119342384
Public Clones not available
Private Clones OST330291 (lexicon)
Severity of mutation (?) Insertion after 88% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000035093
Sequence
GCGGGAAGCAGAGCGCAGCCGCCGCCGGGCCCTGCGCGCCCCGGGAGCGCAGCGCGGCCCTGCCCGCGGGCTCCGGGTGTCCGCGGGGCGGCGCCGCGGA

ACATGACGGCGCCCTGGGCGGCCCTCGCCCTTCTCTGGGGATCGCTGTGCGCCG - UNI22279 - GTTCCGGGCGAGGGGAGGCTGAGACTCGGGAG

TGCATCTACTACAACGCCAACTGGGAGCTGGAGCGCACCAACCAGAGCGGCCTGGAGCGCTGCGAGGGGGAACAGGACAAGCGGCTGCACTGCTACGCCT

CGTGGCGCAACAGCTCGGGCACCATCGAGCTGGTGAAGAAGGGCTGCTGGCTAGATGACTTCAATTGCTACGACAG - UNI27874 - GCAGGAGTGT

GTGGCCACCGAGGAGAACCCCCAGGTGTACTTCTGCTGCTGCGAAGGCAACTTCTGCAACGAGCGCTTCACCCACTTGCCGGAGCCTGGGGGCCCAGAAG

 TCACGTACGAGCCACCCCCGACAGCCCCCACCCTGCTCACGGTGCTGGCCTACTCGCTGCTGCCCATTGGAGGCCTCTCTCTCATCGTCCTGCTGGCCT

TCTGGATGTATCGTCATCGGAAGCCTCCCTACGGCCATGTGGACATCCATGAGGTGAGACAGTGCCAGCGTTGGGCAGGGAGAAGGGACGGCTGTGCGGA

CTCCTTTAAGCCCTTGCCTTTCCAGGACCCGGGGCCTCCGCCCCCATCCCCTCTGGTGGGCCTGAAGCCACTACAGCTGCTGGAGATCAAGGCTCGGGGC

CGCTTTGGCTGCGTTTGGAAAGCTCAGCTCATGAACGACTTTGTGGCTGTGAAGATCTTCCCACTTCAG GACAAGCAGTCGTGGCAGAGTGAACGGGAA

ATCTTCAGCACACCCGGCATGAAGCACGAAAACTTGTTGCAGTTCATTGCTGCCGAGAAACGAGGCTCCAACCTGGAGGTGGAGCTGTGGCTCATCACAG

CCTTCCACGACAAG GGCTCCCTCACGGATTACCTCAAGGGGAACATCATCACGTGGAACGAACTGTGCCACGTGGCGGAGACGATGTCACGAGGCCTCT

CATACCTGCATGAGGATGTGCCGTGGTGTCGTGGTGAGGGCCACAAGCCTTCTATTGCCCACAG GGACTTCAAAAGCAAGAATGTACTGCTGAAGAGCG

ACCTCACCGCGGTGCTGGCTGACTTCGGCCTGGCTGTTCGGTTTGAGCCAGGGAAGCCTCCTGGGGATACCCATGGACAG GTTGGCACCAGACGGTACA

TGGCCCCTGAGGTGCTGGAAGGAGCCATCAACTTCCAGAGAGACGCCTTCCTGCGTATCGACATGTACGCCATGGGCCTGGTGCTGTGGGAGCTCGTCTC

TCGGTGCAAGGCTGCAGACG GGCCTGTCGATGAGTACATGCTGCCCTTCGAGGAGGAGATTGGCCAGCACCCTTCGCTGGAGGAGCTTCAGGAGGTGGT

TGTCCACAAGAAGATGAGGCCCACGATTAAGGATCACTGGCTGAAACACCCG - UNI21431 - GGCCTGGCCCAGCTCTGCGTGACCATCGAGGAGT

GCTGGGACCATGATGCAGAGGCTCGCCTTTCTGCAGGCTGTGTAGAAGAGCGGGTATCCCTGATCAGGAGGTCGGTCAACGGCACTACCTCGGACTGTCT

CGTCTCTCTGGTGACCTCCGTCACCAATGTGGACCTGCTCCCTAAAGAGTCCAGCATCTAAGCCCGGGACACGTAGCGTCTCTCCAGACTCAGTGGATCT

G
Translation
MTAPWAALALLWGSLCAG - UNI22279 - GSGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCY

DR - UNI27874 - RQECVATEENPQVYFCCCEGNFCNERFTHLPEPGGPEV VTYEPPPTAPTLLTVLAYSLLPIGGLSLIVLLAFWMYRHRKPPYG

HVDIHEVRQCQRWAGRRDGCADSFKPLPFQDPGPPPPSPLVGLKPLQLLEIKARGRFGCVWKAQLMNDFVAVKIFPLQ DKQSWQSEREIFSTPGMKHEN

LLQFIAAEKRGSNLEVELWLITAFHDK GSLTDYLKGNIITWNELCHVAETMSRGLSYLHEDVPWCRGEGHKPSIAHR RDFKSKNVLLKSDLTAVLADF

GLAVRFEPGKPPGDTHGQ VGTRRYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELVSRCKAADG GPVDEYMLPFEEEIGQHPSLEELQEVVVHKKMR

PTIKDHWLKHP - UNI21431 - GLAQLCVTIEECWDHDAEARLSAGCVEERVSLIRRSVNGTTSDCLVSLVTSVTNVDLLPKESSI
Transcript ENSMUST00000111699
Sequence
GCGGGAAGCAGAGCGCAGCCGCCGCCGGGCCCTGCGCGCCCCGGGAGCGCAGCGCGGCCCTGCCCGCGGGCTCCGGGTGTCCGCGGGGCGGCGCCGCGGA

ACATGACGGCGCCCTGGGCGGCCCTCGCCCTTCTCTGGGGATCGCTGTGCGCCG - UNI22279 - GTTCCGGGCGAGGGGAGGCTGAGACTCGGGAG

TGCATCTACTACAACGCCAACTGGGAGCTGGAGCGCACCAACCAGAGCGGCCTGGAGCGCTGCGAGGGGGAACAGGACAAGCGGCTGCACTGCTACGCCT

CGTGGCGCAACAGCTCGGGCACCATCGAGCTGGTGAAGAAGGGCTGCTGGCTAGATGACTTCAATTGCTACGACAG - UNI27874 - GCAGGAGTGT

GTGGCCACCGAGGAGAACCCCCAGGTGTACTTCTGCTGCTGCGAAGGCAACTTCTGCAACGAGCGCTTCACCCACTTGCCGGAGCCTGGGGGCCCAGAAG

 TCACGTACGAGCCACCCCCGACAGCCCCCACCCTGCTCACGGTGCTGGCCTACTCGCTGCTGCCCATTGGAGGCCTCTCTCTCATCGTCCTGCTGGCCT

TCTGGATGTATCGTCATCGGAAGCCTCCCTACGGCCATGTGGACATCCATGAG GACCCGGGGCCTCCGCCCCCATCCCCTCTGGTGGGCCTGAAGCCAC

TACAGCTGCTGGAGATCAAGGCTCGGGGCCGCTTTGGCTGCGTTTGGAAAGCTCAGCTCATGAACGACTTTGTGGCTGTGAAGATCTTCCCACTTCAG G

ACAAGCAGTCGTGGCAGAGTGAACGGGAAATCTTCAGCACACCCGGCATGAAGCACGAAAACTTGTTGCAGTTCATTGCTGCCGAGAAACGAGGCTCCAA

CCTGGAGGTGGAGCTGTGGCTCATCACAGCCTTCCACGACAAG GGCTCCCTCACGGATTACCTCAAGGGGAACATCATCACGTGGAACGAACTGTGCCA

CGTGGCGGAGACGATGTCACGAGGCCTCTCATACCTGCATGAGGATGTGCCGTGGTGTCGTGGTGAGGGCCACAAGCCTTCTATTGCCCACAG GGACTT

CAAAAGCAAGAATGTACTGCTGAAGAGCGACCTCACCGCGGTGCTGGCTGACTTCGGCCTGGCTGTTCGGTTTGAGCCAGGGAAGCCTCCTGGGGATACC

CATGGACAG GTTGGCACCAGACGGTACATGGCCCCTGAGGTGCTGGAAGGAGCCATCAACTTCCAGAGAGACGCCTTCCTGCGTATCGACATGTACGCC

ATGGGCCTGGTGCTGTGGGAGCTCGTCTCTCGGTGCAAGGCTGCAGACG GGCCTGTCGATGAGTACATGCTGCCCTTCGAGGAGGAGATTGGCCAGCAC

CCTTCGCTGGAGGAGCTTCAGGAGGTGGTTGTCCACAAGAAGATGAGGCCCACGATTAAGGATCACTGGCTGAAACACCCG - UNI21431 - GGCCT

GGCCCAGCTCTGCGTGACCATCGAGGAGTGCTGGGACCATGATGCAGAGGCTCGCCTTTCTGCAGGCTGTGTAGAAGAGCGGGTATCCCTGATCAGGAGG

TCGGTCAACGGCACTACCTCGGACTGTCTCGTCTCTCTGGTGACCTCCGTCACCAATGTGGACCTGCTCCCTAAAGAGTCCAGCATCTAAGCCCGGGACA

CGTAGCGTCTCTCCAGACTCAGTGGATCTG
Translation
MTAPWAALALLWGSLCAG - UNI22279 - GSGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCY

DR - UNI27874 - RQECVATEENPQVYFCCCEGNFCNERFTHLPEPGGPEV VTYEPPPTAPTLLTVLAYSLLPIGGLSLIVLLAFWMYRHRKPPYG

HVDIHE DPGPPPPSPLVGLKPLQLLEIKARGRFGCVWKAQLMNDFVAVKIFPLQ DKQSWQSEREIFSTPGMKHENLLQFIAAEKRGSNLEVELWLITA

FHDK GSLTDYLKGNIITWNELCHVAETMSRGLSYLHEDVPWCRGEGHKPSIAHR RDFKSKNVLLKSDLTAVLADFGLAVRFEPGKPPGDTHGQ VGTR

RYMAPEVLEGAINFQRDAFLRIDMYAMGLVLWELVSRCKAADG GPVDEYMLPFEEEIGQHPSLEELQEVVVHKKMRPTIKDHWLKHP - UNI21431 

- GLAQLCVTIEECWDHDAEARLSAGCVEERVSLIRRSVNGTTSDCLVSLVTSVTNVDLLPKESSI

For any suggestions or comments, please send an email to unitrap@crg.es