Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000061411 (8430427H17Rik)
Chromosomal location
Chr 2: 153233198 - 153355709 (-)
Description
RIKEN cDNA 8430427H17 gene Gene [Source:MGI Symbol;Acc:MGI:1918765]
RefSeq_peptide
NP_001001986.1 NP_001127772.1 
UniGene
Mm.50600 Mm.447504 Mm.468717 
MGI
MGI:1918765 
Uniprot/SWISSPROT
Q6DIB4 
Uniprot/SPTREMBL
Q3TPB4 Q3TZG8 Q3UH85 Q52KQ8 Q6AXH3 
Human Ortholog
ENSG00000197183 (C20orf112)
Omim not available
UniTrap UNI20766
Vector Insertion
Chr 2: 153309579 - 153355177
Public Clones (sanger) IST14948G12 (tigm) IST13568D11 (tigm) IST11076C6 (tigm)
IST10464G1 (tigm)
Private Clones OST352736 (lexicon) OST314736 (lexicon) OST288107 (lexicon) OST99852 (lexicon)
OST55287 (lexicon)
Severity of mutation (?) Insertion after 16% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI16200
Vector Insertion
Chr 2: 153303719 - 153309422
Public Clones not available
Private Clones OST465222 (lexicon) OST416173 (lexicon) OST292451 (lexicon) OST290604 (lexicon)
OST246770 (lexicon)
Severity of mutation (?) Insertion after 23% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20653
Vector Insertion
Chr 2: 153296534 - 153303606
Public Clones not available
Private Clones OST355687 (lexicon) OST232240 (lexicon) OST214893 (lexicon) OST194886 (lexicon)
Severity of mutation (?) Insertion after 29% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33001
Vector Insertion
Chr 2: 153270092 - 153296534
Public Clones (ggtc) IST12868D7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI27663
Vector Insertion
Chr 2: 153262084 - 153270092
Public Clones (ggtc) IST14997F11 (tigm)
Private Clones OST54265 (lexicon)
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI19184
Vector Insertion
Chr 2: 153246546 - 153261941
Public Clones (ggtc)
Private Clones OST403072 (lexicon) OST155094 (lexicon) OST64149 (lexicon) OST33532 (lexicon)
Severity of mutation (?) Insertion after 41% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000035346
Sequence
CCGCCGCCGCCGCCCGAGCAGGACAGAGCGCGCCGCAGCCCCGCGCGTCCGGCCGCCGCCCGCGCCCATCCAGCAGCCGCGCCAGAGCCACACCGCGGGA

CAGCCCGGGCCGCGGCGCGCCCCTGCCCAGCCCGGCCCAGCCCAGCCCAGTTCCAGCACCGGGCGGCCCGGTGGCCGGCCCGCCCCCGAGGGCGCCGGGC

GCGGCGGGAGGATGCCGAAGCCGACGCTGCTGCTGCGCGGGGGCTGGGAGCGCGAGCGCAGCCCCGGGGACTCGGAGCTGGGCCGCCAGTTCCGGGACTG

GTGCCTGCGCACCTACGGCGACTCGGCTAAAACCAAGACAGTGACACGCAGCAAATACCAGCGGATCGCCGAGGTCCTGCAGGGTGGCGGCGGGACCGGC

GCGGGCAGCGGCCCGGCGGCGGGCGAGAAAGGCAAGTTCCAGTTCTGGGTGCGCTCCAAGGGCTTCCGCCTGGGCAGCGGCCGGGAACCCAAGATGGGCC

AAGTGGTGTATGTGCCGGTCAAGACGGGCTCG - UNI20766 - GGGGCAGATGGCCTGTCGGAGCCCGAGGGCATCTCTCTGAAACGCGTTGCTGTG

GTGGAAGATTTCTTTGACATCATCTACTCGATGCACGTGGAGAGCTCTGCAGAGCCAGGCAAAGCCCCCAAGCACGCTGGGCAGAAGAAAACCTACCGAG

CG - UNI16200 - ATCGCGGAGACCTACGCCTTCCTCCCCAGAGAGGCTGTGACTCGGTTCCTCATGAGCTGCACGGAATGCCAGAAGAGGATGCAC

TTTAACTCCAGCGGCCCGGAGCCCAAAG - UNI20653 - - UNI33001 - AGAATGAGCCTCCATCCCCTCTGGTGTCTGGCATTATTGATTACA

ACATGCCCCTCACCTCTACCTACTTGAAGCAGATGAAGCTGCGAGTGATGAACTCTCAGGAGCAG - UNI27663 - - UNI33001 - GATGAAAC

GTCTGTGAGCAGTGAAGACTTTGATATGAATGACTCCGCATGGATGTCAGCTGACCCCCACCTGGCCTCCAGCCTTAGCCCCAGCCAAGAGGAGAGGATG

CGGAGCCCACAGAACCTCCATAGCCAGGAGGATG - UNI19184 - ATGACTCCTCCTCTGAGAGCGGCAGCGGCAATGGCTCTTCTACCCTGAACCC

ATCCACTTCAAGCAGCACACAGGGGGACCCCGCCTTCCCTGAGATGAATGGCAACGGAGCTGCAGCCCCCATGGACTTCACCGCCACTGCCGAGGACCAG

CCCATTAACCTGTGTGAGAAGCTCCCGCCCGGCACAGCTCTGGGCACGCCGTCCTACCCCTCAGACGGCTGCGGCACTGATGGGCTGCGGAGCCGCGTCA

AGTATGGGGTAAAGAACACCCCCGAG TCACCCCCATACAGCTCCGGGAGCTATGATTCCATCAAGACTGAAGTCAGTGGCTGTCCTGAGGACCTGACAG

TGGGCCGGGCCCCTGCAGCAGATGACGATGACGATGACCATGATGACCATGAGGACAATGACAAGATGAATGACTCAGAGGGCATGGACCCCGAGCGGCT

CAAGGCCTTCAAC ATGTTCGTGCGGCTCTTCGTGGATGAGAACCTGGACCGCATGGTGCCCATTTCCAAGCAGCCCAAGGAGAAGATCCAGGCCATCAT

CGAGTCCTGCAGCCGGCAATTCCCTGAGTTCCAGGAGCGGGCCCGCAAGCGCATCCGCACATACCTCAAGTCCTGCCGCCGCATGAAGAAGAACGGCATG

GAGATG ACCAGACCTACTCCTCCGCATCTGACCTCAGCCATGGCAGAGAACATCCTAGCAGCTGCCTGTGAGAGTGAGACGAGAAAGGCAGCCAAGAGG

ATGCGCCTGGAGATCTACCAGTCCTCACAA GAAGAACCCATAGCCCTGGATAAGCAGCACTCTCGGGACTCTACAGCCATCACCCACTCCACCTACTCA

CTGCCAGCCTCTGCCTACTCCCAGGACCCCGTGTATGTCAACGGTGGCCTCAATTACAGCTACCGTGGCTATGGGTCCTTGAGCAGCAACTTGCAGCCCT

CTGCTTCCCTCCAGACAGGAAATCACAGTAATG GGCCCACAGACCTCAGCATGAAAGGCGGGGCCTCTACCCCAACTCCTCCCACGCCTACCCCTTCCA

GCAACAGCACCAGCAGGACCATGCCCACAGCCCAGCTTAGCCCCACGGAGATCAGTGCTGTGCGGCAGCTCATCGCAGGCTATCGAGAGTCTGCAGCCTT

CCTGCTGCGTTCTGCAGATGAACTGGAAAACCTCATTTTACAGCAGAACTGACCCTGCTGGCCCCCAGAGTGCACGACGCCAGGAGGCTGTCCCAGCCTG

GACCCAGCTTCCTGCCTCACCAGTTGGTACACTGTTTTCTGAAAGAGGTGGGATCCAAAAGAGCTGTTTCTAGCTGCACTCCAAGCATCTGAGACTTTGG

GCACAAGGACACTTTTCTTTTCTTTTTTTTTTTTTAATTTCACCACATGGGTGCTCTGACCTGCTTGGAAAGAGGCCAGTGGGGCAGCTCTAAAAGGGTT

GAGGTTCCCCTGAAAAGGCACAGGGGCTACAGCTCTATTTAGAATCACCTTTGTGGACCACGATGTTAGAACTCCCCCCCCCCATAATTACCTTTCAAGT

CTTAGGTGAGCAGAATTGCATATTTATTGAGAAGAGCAAAAGTGGACCCTTTCTCTCCCCTTAGTAATTTATTTTTCTGAAATGGATTCTTTTGTGTTTG

TACAGATTGCCAGTCTGTGTCTGTCTAATCAGAAGGATGGATCCCTGTACCTAACATTCCATATCACTACACTGATGTGAGCTGGGGGCCAGCAGAGTTG

GGGGCCAGCTCACTGTCCCGAGTGCCCAGCATACCCTTGGGAAGGCCACCACACTCCACCACTAGGCTGTCTTGTTGCAGATCCCAGTGCTGCCACAGGG

ACACTGCCAAACAGAGGGACCTCACCAACACTCACTACAAACAAAAGCAGCCACCCATCCCATCCGACAGAGTCCCAGTCACACGGTCACCTGTACTCTA

CCTCACACTCCAGCGTGGGCTTTTCCAGGACGTGCTCCAAGTGTGTTCTGAACGGCTGTCTCCCCCAACTCCCACACAATGTAGCTATCTTCTGGGAGGT

AAATGAGACCCAGTGTCCAGGAGCCAGAGCCCAGAGGGGCTTGGCCCTTAAAACCAGCAGCTTGCCATAGCCTGGGCTCTTGGAGATGCTTGACAGGATA

GTGTGTCTGGAGCTGGTCCAGGTCCCACACAGCCCCCAGGTAACCTGCTGAGGGGCCACTTCTCTTGGCCAGGCATCTGTGTGCCCAAGGGTGAATTATG

GTTTCCACTCCTCACCTCACGATGGGAGTAGAGGGATCAGATCGTTGGTGGAAGTGCAGAACTACTTGCATTCTCCTAAGATCAAACTTTCTTCTGGAAA

GGCCTGTCCTGTAAGAAACCTAGTCCCTGGAGTGTGACAAGGGACAAGAAAAAGCTGACCTGGTTTCCTTCCTCCCTGACAGGCACTTCCTCTTGCTCTG

TGCAATACCTACCAGTGCTGCTAAAACCAGGGATTCACCCAGACCTCAGCAGGCCAGGGGGCCTCTCCCTCAACACTCCGTAGCCATGACAGCAGCACTC

TGCTGCCTGCCCCTGCCCAGAGATGGCAGAAGCCCTGTTGCCTTTCTTCCCTCAGAGCTAGGAGGCCTCAAGGGAGCCAGGGCTGAGTGGACACTAAGCT

AACCACAAAGAGCCACTCTTGGTCCCAGAGCGAGTGCCCCTTCCCAAACTGGTCTATGGCAGGGACTGCTTGTGGCAGCCTGACAGACTACCCTTCAAAC

AGGTAGGCAAGCAGTGCCAGTGCAGATACCCTACCTGTTCAGATTCAGGGCTGTAAGGCAGGGTTCCCCACCCTGCACACTTCCACACTGGGGTTAAATG

TGGTCTTTCACATGGCCTACAATGCCTACCCAGCCACACCACCTCTGCCTTCATGTGCCCGCTCACCAGGCCTCTGGACTGGGCCAGGACACCTGAGCCC

CTTCATACAGCACAAACTCCAGTGCCCAGGCCTCCCCACAGCTGGCCAAACATGTGCCCAGTTCCCCACCTGCTCAGTAGGACTCCTGGATGTTTGAATT

TGTGTAAATATTTATTTTTGTGTGTGAATACTACAAAGTAATCAGTAGATCTTTTTGCAAAATGTTACTCCAGGCAATTTGTGAAAATGTTGAAAATTGG

CAGAGACAATCGCCACCCTAGAATTTCTGTTATCAATTGCTTACCGCATTCTGTCTGCTCCCAGAGGCAGTACCCAAGCTAGACACAAATGGCTTGCATT

TTTGGAAGAAGATAGAAGAGACTAGGCAGGGGCTCCTCCCTCTATCCCCACAGGACACATCTGTAAGGACGAGCATAATCTATATCTAAGTGGTATTTTC

TAACTGCAAGCAGTCTTGACCAGCCACTAGCAGCCTGCTCCTAGAGTACGGTGTGAGCATAGGTTCCATGTGTTTTGCTTTCAAGAGAAATAAAACCAAT

GCCAGTGCTGATGGTTTCCAGAGGGGCTGCAGGACAGTAGTAGATGCTGGCATGCTGACCTGGGCTTCTTCCCAGAGAAGTGGTCTCCAAAGCCTCAGAG

CAGCCATACCAGGAGCAAGTCAGTGTGGACACAGGATTCCATTACCTAGTTAAGTCAGGGAACTTGTTCTGTTTTCCTTTTGTTTTAAAAGATGCAGCGT

CAAGCCTCCCTTCCTGACTGTGGCCCGCCTTTTCCCAGGAGGAGCTTCCCAAAGCCTTGTCCTGCAGCCACTGCAGTGTGATGGAAGCCTCAGGCACACA

GTAGTCATTGGTGATCTCAAGTCATAGTGAACATGCCAGTGCAGGATGCACCCCCCCTCACCCCCGAGTCCTTACAGGCAGATCCCTGCAGGCTATCAAG

AGAAGTGGTGGATGATCATCTGTTAGACCAGGGATAGTATACAGGACCCATCTGAAAGCATTTTTTTTTCCTCTCACCACTCAACAAATGGACAGTTTAT

TCCCAAGGACGGTGTTGGGGAGAGGCAGGCAGGGCCAGGAGGGTCTTGGAGGACTTTGAACAGGTGGAACCCATCTGTCCCTCCCTATTTCTCAAGGGCC

ACAAATGACTCCACAGGTGGTTATAGGATTAACTACCAGTTCATTCTCAAAATGCTGCTTTGAACTCAGAGGGTTGATACTTTTAATTTGTAATTTTTTG

TAAAACTTTTTACAAGATAGTAAAGTATTTCACCAGAATACCAGTTTCAATCCGTCCGTGGTCTGATTTTATATAATTTAGTGGTGCTTTAGAGACTTTG

TTTTGTTGTTTCTGAGCGCAACAGCTCAATCCTCTCTTGCCTGTATCTACCTAAGACCAATGTGAACCTTTGTATTTTGCTCCTAATTTTGGACTCAGTG

GAAGTGTACTGTTTACATGTACAGATGCCCCATCCCTGTGTTTTCTGCAAGACGCACGCTCGAGGAGGAAGATTGCACCTCACTAGCTCATCTGCTTAGC

AAAGCCACAAAACAAAACCTCTCACTTTGTACCCGTTTCCACCTAAAAAACAAAAACCTTCACCACCTGGAACTCAGATTTGCCAACACATTCTGCCTGG

TAGATGCCCCATGCCTCTATCATGTGTTCCCTTAGGAATCAAGGCAGCACCTCCTGCCAGCTGGGTGGGGGATAGCACACAGTGGAGACATTAATGCAGG

ACTTTACTGCCCAGCTCTGGGAGGAAGTTCTTCTTTGGGCAGGAGGCAGTATGAAGGTCAACTCATGGGCCTTCAGGAGCAAGCCAGGCAGGATTTAGGG

ACAACACAAGAGGCCATCAATCTGCTGGCATGATTGAGACACACTTTGGAAGAGCATGAGTTCCATGTAAGGTGAGACTGTGACTTTGAGTGCAGATGAC

ACAGCACTTCAGGGGAGGGTCAGGGGCTCCAGACAGTAAGCATAAGGCACTTACCGCAAGCAGTGGATGGCACCAACTTTTAAAGGTGACTTTATTAATC

AATGGTTTCACCGCTAAATTATATTTTTACAGATATGCACCTATGCAACTTAATGTGGCTCTTCTAAGCAGGTGAGGACCTCCTCCTCAATGCTCTATAA

AGTGTTTGTGTTCTGTATAGTGAGTTTCCCAGTAAATGTGGCTTAATACTTTAATTCTTAGGATGTGTCTTTCTACGTGATGCAGCTACTAAATTCTGTT

TTGTTTGTGGAATGACTAGCACAGGCCGACGCCCTCTTTCCCTCACTTACCAGAAGACCAATGAGCTGTTAATGAGCGGTTATCTCCATGGTATTACTGC

TAAATGCACTGATGTCATAAGTATGTGGAATCCTTTTCCTTTTGAGACTGTATATCATATACCAGACTGAATCTACTTAATAAACACTGAACAACAAACC

TT
Translation
MPKPTLLLRGGWERERSPGDSELGRQFRDWCLRTYGDSAKTKTVTRSKYQRIAEVLQGGGGTGAGSGPAAGEKGKFQFWVRSKGFRLGSGREPKMGQVVY

VPVKTGS - UNI20766 - GADGLSEPEGISLKRVAVVEDFFDIIYSMHVESSAEPGKAPKHAGQKKTYRA - UNI16200 - IAETYAFLPREAV

TRFLMSCTECQKRMHFNSSGPEPKE - UNI20653 - - UNI33001 - ENEPPSPLVSGIIDYNMPLTSTYLKQMKLRVMNSQEQ - UNI27663

 - - UNI33001 - DETSVSSEDFDMNDSAWMSADPHLASSLSPSQEERMRSPQNLHSQEDD - UNI19184 - DDSSSESGSGNGSSTLNPSTSS

STQGDPAFPEMNGNGAAAPMDFTATAEDQPINLCEKLPPGTALGTPSYPSDGCGTDGLRSRVKYGVKNTPE SPPYSSGSYDSIKTEVSGCPEDLTVGRA

PAADDDDDDHDDHEDNDKMNDSEGMDPERLKAFN MFVRLFVDENLDRMVPISKQPKEKIQAIIESCSRQFPEFQERARKRIRTYLKSCRRMKKNGMEM 

TRPTPPHLTSAMAENILAAACESETRKAAKRMRLEIYQSSQ EEPIALDKQHSRDSTAITHSTYSLPASAYSQDPVYVNGGLNYSYRGYGSLSSNLQPSA

SLQTGNHSNG GPTDLSMKGGASTPTPPTPTPSSNSTSRTMPTAQLSPTEISAVRQLIAGYRESAAFLLRSADELENLILQQN
Transcript ENSMUST00000109784
Sequence
TCTCCTCCGGCGGCCGCGGCGGCAGCAGCAGCAGCAGCAGCTGGAGCAGTGGGGCTGTCACCGCCTCCCGCCCGGTTCACTCCCAGAGCTAGATCGCCGA

TCAGCACCTCGCCGCCCGCCCAG - UNI27663 - - UNI33001 - GATGAAACGTCTGTGAGCAGTGAAGACTTTGATATGAATGACTCCGCATG

GATGTCAGCTGACCCCCACCTGGCCTCCAGCCTTAGCCCCAGCCAAGAGGAGAGGATGCGGAGCCCACAGAACCTCCATAGCCAGGAGGATG - UNI19

184 - ATGACTCCTCCTCTGAGAGCGGCAGCGGCAATGGCTCTTCTACCCTGAACCCATCCACTTCAAGCAGCACACAGGGGGACCCCGCCTTCCCTGA

GATGAATGGCAACGGAGCTGCAGCCCCCATGGACTTCACCGCCACTGCCGAGGACCAGCCCATTAACCTGTGTGAGAAGCTCCCGCCCGGCACAGCTCTG

GGCACGCCGTCCTACCCCTCAGACGGCTGCGGCACTGATGGGCTGCGGAGCCGCGTCAAGTATGGGGTAAAGAACACCCCCGAG TCACCCCCATACAGC

TCCGGGAGCTATGATTCCATCAAGACTGAAGTCAGTGGCTGTCCTGAGGACCTGACAGTGGGCCGGGCCCCTGCAGCAGATGACGATGACGATGACCATG

ATGACCATGAGGACAATGACAAGATGAATGACTCAGAGGGCATGGACCCCGAGCGGCTCAAGGCCTTCAAC ATGTTCGTGCGGCTCTTCGTGGATGAGA

ACCTGGACCGCATGGTGCCCATTTCCAAGCAGCCCAAGGAGAAGATCCAGGCCATCATCGAGTCCTGCAGCCGGCAATTCCCTGAGTTCCAGGAGCGGGC

CCGCAAGCGCATCCGCACATACCTCAAGTCCTGCCGCCGCATGAAGAAGAACGGCATGGAGATG ACCAGACCTACTCCTCCGCATCTGACCTCAGCCAT

GGCAGAGAACATCCTAGCAGCTGCCTGTGAGAGTGAGACGAGAAAGGCAGCCAAGAGGATGCGCCTGGAGATCTACCAGTCCTCACAA GAAGAACCCAT

AGCCCTGGATAAGCAGCACTCTCGGGACTCTACAGCCATCACCCACTCCACCTACTCACTGCCAGCCTCTGCCTACTCCCAGGACCCCGTGTATGTCAAC

GGTGGCCTCAATTACAGCTACCGTGGCTATGGGTCCTTGAGCAGCAACTTGCAGCCCTCTGCTTCCCTCCAGACAGGAAATCACAGTAATG GGCCCACA

GACCTCAGCATGAAAGGCGGGGCCTCTACCCCAACTCCTCCCACGCCTACCCCTTCCAGCAACAGCACCAGCAGGACCATGCCCACAGCCCAGCTTAGCC

CCACGGAGATCAGTGCTGTGCGGCAGCTCATCGCAGGCTATCGAGAGTCTGCAGCCTTCCTGCTGCGTTCTGCAGATGAACTGGAAAACCTCATTTTACA

GCAGAACTGACCCTGCTGGCCCCCAGAGTGCACGACGCCAGGAGGCTGTCCCAGCCTGGACCCAGCTTCCTGCCTCACCAGTTGGTACACTGTTTTCTGA

AAGAGGTGGGATCCAAAAGAGCTGTTTCTAGCTGCACTCCAAGCATCTGAGACTTTGGGCACAAGGACACTTTTCTTTTCTTTTTTTTTTTTTAATTTCA

CCACATGGGTGCTCTGACCTGCTTGGAAAGAGGCCAGTGGGGCAGCTCTAAAAGGGTTGAGGTTCCCCTGAAAAGGCACAGGGGCTACAGCTCTATTTAG

AATCACCTTTGTGGACCACGATGTTAGAACTCCCCCCCCCCATAATTACCTTTCAAGTCTTAGGTGAGCAGAATTGCATATTTATTGAGAAGAGCAAAAG

TGGACCCTTTCTCTCCCCTTAGTAATTTATTTTTCTGAAATGGATTCTTTTGTGTTTGTACAGATTGCCAGTCTGTGTCTGTCTAATCAGAAGGATGGAT

CCCTGTACCTAACATTCCATATCACTACACTGATGTGAGCTGGGGGCCAGCAGAGTTGGGGGCCAGCTCACTGTCCCGAGTGCCCAGCATACCCTTGGGA

AGGCCACCACACTCCACCACTAGGCTGTCTTGTTGCAGATCCCAGTGCTGCCACAGGGACACTGCCAAACAGAGGGACCTCACCAACACTCACTACAAAC

AAAAGCAGCCACCCATCCCATCCGACAGAGTCCCAGTCACACGGTCACCTGTACTCTACCTCACACTCCAGCGTGGGCTTTTCCAGGACGTGCTCCAAGT

GTGTTCTGAACGGCTGTCTCCCCCAACTCCCACACAATGTAGCTATCTTCTGGGAGGTAAATGAGACCCAGTGTCCAGGAGCCAGAGCCCAGAGGGGCTT

GGCCCTTAAAACCAGCAGCTTGCCATAGCCTGGGCTCTTGGAGATGCTTGACAGGATAGTGTGTCTGGAGCTGGTCCAGGTCCCACACAGCCCCCAGGTA

ACCTGCTGAGGGGCCACTTCTCTTGGCCAGGCATCTGTGTGCCCAAGGGTGAATTATGGTTTCCACTCCTCACCTCACGATGGGAGTAGAGGGATCAGAT

CGTTGGTGGAAGTGCAGAACTACTTGCATTCTCCTAAGATCAAACTTTCTTCTGGAAAGGCCTGTCCTGTAAGAAACCTAGTCCCTGGAGTGTGACAAGG

GACAAGAAAAAGCTGACCTGGTTTCCTTCCTCCCTGACAGGCACTTCCTCTTGCTCTGTGCAATACCTACCAGTGCTGCTAAAACCAGGGATTCACCCAG

ACCTCAGCAGGCCAGGGGGCCTCTCCCTCAACACTCCGTAGCCATGACAGCAGCACTCTGCTGCCTGCCCCTGCCCAGAGATGGCAGAAGCCCTGTTGCC

TTTCTTCCCTCAGAGCTAGGAGGCCTCAAGGGAGCCAGGGCTGAGTGGACACTAAGCTAACCACAAAGAGCCACTCTTGGTCCCAGAGCGAGTGCCCCTT

CCCAAACTGGTCTATGGCAGGGACTGCTTGTGGCAGCCTGACAGACTACCCTTCAAACAGGTAGGCAAGCAGTGCCAGTGCAGATACCCTACCTGTTCAG

ATTCAGGGCTGTAAGGCAGGGTTCCCCACCCTGCACACTTCCACACTGGGGTTAAATGTGGTCTTTCACATGGCCTACAATGCCTACCCAGCCACACCAC

CTCTGCCTTCATGTGCCCGCTCACCAGGCCTCTGGACTGGGCCAGGACACCTGAGCCCCTTCATACAGCACAAACTCCAGTGCCCAGGCCTCCCCACAGC

TGGCCAAACATGTGCCCAGTTCCCCACCTGCTCAGTAGGACTCCTGGATGTTTGAATTTGTGTAAATATTTATTTTTGTGTGTGAATACTACAAAGTAAT

CAGTAGATCTTTTTGCAAAATGTTACTCCAGGCAATTTGTGAAAATGTTGAAAATTGGCAGAGACAATCGCCACCCTAGAATTTCTGTTATCAATTGCTT

ACCGCATTCTGTCTGCTCCCAGAGGCAGTACCCAAGCTAGACACAAATGGCTTGCATTTTTGGAAGAAGATAGAAGAGACTAGGCAGGGGCTCCTCCCTC

TATCCCCACAGGACACATCTGTAAGGACGAGCATAATCTATATCTAAGTGGTATTTTCTAACTGCAAGCAGTCTTGACCAGCCACTAGCAGCCTGCTCCT

AGAGTACGGTGTGAGCATAGGTTCCATGTGTTTTGCTTTCAAGAGAAATAAAACCAATGCCAGTGCTGATGGTTTCCAGAGGGGCTGCAGGACAGTAGTA

GATGCTGGCATGCTGACCTGGGCTTCTTCCCAGAGAAGTGGTCTCCAAAGCCTCAGAGCAGCCATACCAGGAGCAAGTCAGTGTGGACACAGGATTCCAT

TACCTAGTTAAGTCAGGGAACTTGTTCTGTTTTCCTTTTGTTTTAAAAGATGCAGCGTCAAGCCTCCCTTCCTGACTGTGGCCCGCCTTTTCCCAGGAGG

AGCTTCCCAAAGCCTTGTCCTGCAGCCACTGCAGTGTGATGGAAGCCTCAGGCACACAGTAGTCATTGGTGATCTCAAGTCATAGTGAACATGCCAGTGC

AGGATGCACCCCCCCTCACCCCCGAGTCCTTACAGGCAGATCCCTGCAGGCTATCAAGAGAAGTGGTGGATGATCATCTGTTAGACCAGGGATAGTATAC

AGGACCCATCTGAAAGCATTTTTTTTTCCTCTCACCACTCAACAAATGGACAGTTTATTCCCAAGGACGGTGTTGGGGAGAGGCAGGCAGGGCCAGGAGG

GTCTTGGAGGACTTTGAACAGGTGGAACCCATCTGTCCCTCCCTATTTCTCAAGGGCCACAAATGACTCCACAGGTGGTTATAGGATTAACTACCAGTTC

ATTCTCAAAATGCTGCTTTGAACTCAGAGGGTTGATACTTTTAATTTGTAATTTTTTGTAAAACTTTTTACAAGATAGTAAAGTATTTCACCAGAATACC

AGTTTCAATCCGTCCGTGGTCTGATTTTATATAATTTAGTGGTGCTTTAGAGACTTTGTTTTGTTGTTTCTGAGCGCAACAGCTCAATCCTCTCTTGCCT

GTATCTACCTAAGACCAATGTGAACCTTTGTATTTTGCTCCTAATTTTGGACTCAGTGGAAGTGTACTGTTTACATGTACAGATGCCCCATCCCTGTGTT

TTCTGCAAGACGCACGCTCGAGGAGGAAGATTGCACCTCACTAGCTCATCTGCTTAGCAAAGCCACAAAACAAAACCTCTCACTTTGTACCCGTTTCCAC

CTAAAAAACAAAAACCTTCACCACCTGGAACTCAGATTTGCCAACACATTCTGCCTGGTAGATGCCCCATGCCTCTATCATGTGTTCCCTTAGGAATCAA

GGCAGCACCTCCTGCCAGCTGGGTGGGGGATAGCACACAGTGGAGACATTAATGCAGGACTTTACTGCCCAGCTCTGGGAGGAAGTTCTTCTTTGGGCAG

GAGGCAGTATGAAGGTCAACTCATGGGCCTTCAGGAGCAAGCCAGGCAGGATTTAGGGACAACACAAGAGGCCATCAATCTGCTGGCATGATTGAGACAC

ACTTTGGAAGAGCATGAGTTCCATGTAAGGTGAGACTGTGACTTTGAGTGCAGATGACACAGCACTTCAGGGGAGGGTCAGGGGCTCCAGACAGTAAGCA

TAAGGCACTTACCGCAAGCAGTGGATGGCACCAACTTTTAAAGGTGACTTTATTAATCAATGGTTTCACCGCTAAATTATATTTTTACAGATATGCACCT

ATGCAACTTAATGTGGCTCTTCTAAGCAGGTGAGGACCTCCTCCTCAATGCTCTATAAAGTGTTTGTGTTCTGTATAGTGAGTTTCCCAGTAAATGTGGC

TTAATACTTTAATTCTTAGGATGTGTCTTTCTACGTGATGCAGCTACTAAATTCTGTTTTGTTTGTGGAATGACTAGCACAGGCCGACGCCCTCTTTCCC

TCACTTACCAGAAGACCAATGAGCTGTTAATGAGCGGTTATCTCCATGGTATTACTGCTAAATGCACTGATGTCATAAGTATGTGGAATCCTTTTCCTTT

TGAGACTGTATATCATATACCAGACTGAATCTACTTAATAAACACTGAACAACAAA
Translation
 - UNI27663 - - UNI33001 - MNDSAWMSADPHLASSLSPSQEERMRSPQNLHSQEDD - UNI19184 - DDSSSESGSGNGSSTLNPSTSS

STQGDPAFPEMNGNGAAAPMDFTATAEDQPINLCEKLPPGTALGTPSYPSDGCGTDGLRSRVKYGVKNTPE SPPYSSGSYDSIKTEVSGCPEDLTVGRA

PAADDDDDDHDDHEDNDKMNDSEGMDPERLKAFN MFVRLFVDENLDRMVPISKQPKEKIQAIIESCSRQFPEFQERARKRIRTYLKSCRRMKKNGMEM 

TRPTPPHLTSAMAENILAAACESETRKAAKRMRLEIYQSSQ EEPIALDKQHSRDSTAITHSTYSLPASAYSQDPVYVNGGLNYSYRGYGSLSSNLQPSA

SLQTGNHSNG GPTDLSMKGGASTPTPPTPTPSSNSTSRTMPTAQLSPTEISAVRQLIAGYRESAAFLLRSADELENLILQQN

For any suggestions or comments, please send an email to unitrap@crg.es