Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000061535 (C1qtnf7)
Chromosomal location
Chr 5: 43906827 - 44010038 (+)
Description
C1q and tumor necrosis factor related protein 7 Gene [Source:MGI (curated);Acc:C1qtnf7-001]
Human Ortholog
not available
Omim not available
UniTrap UNI36115
Vector Insertion
Chr 5: 43907226 - 43993160
Public Clones IST11842G4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35701
Vector Insertion
Chr 5: 44000538 - 44006858
Public Clones IST10804G5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 28% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000121872
Sequence
AGGAAAGATCCTGACTTTTGTACACTGGGAATCCTGCAGCAACCTACCCTCCCAGAACACG AGCCCAAGATGATTGTCCTGCTCTACGTGACGAGTCTT

GCCATCTGTGCAAGTGGACAACCTCGGGCCAATCAGGCTAAGGGAGAGAGCTACTCTCCAAGGTACATCTGCAGCATCCCTGGATTACCTGGGCCCCCAG

GTCCTCCTGGAGCAAATGGCTCCCCTGGACCCCATGGTCGCATTGGCCTTCCTGGAAGGGATGGTAGAGATGGCAGAAAAGGAGAGAAGGGGGAAAAGGG

CACTGCAG - UNI35701 - GTCTAAAAGGTAAAACTGGACCCCTGGGCCTTGCTGGTGAGAAAGGAGACCAAGGAGAAACTGGAAAGAAAGGACCCA

TAGGACCAGAGGGTGAGAAAGGAGAAGTCGGTCCAGCTGGGCCTCCTGGGCCAAAGGGAGACAGAGGAGATCAAGGGGACCCAGGGCTGCCTGGAGTGTG

CAGGTGTGGAAGCATTGTGCTCAAATCTGCCTTTTCAGTTGGCATCACAACCAGCTACCCAGAAGAAAGACTACCCATCATATTTAACAAAGTCCTCTTC

AATGAGGGGGAGCATTACAACCCTGCAACGGGGAAGTTCATTTGCGCTTTCCCAGGGATCTATTACTTTTCTTATGACATCACGTTGGCCAATAAGCACC

TAGCAATCGGGCTGGTGCACAATGGGCAGTACCGGATAAGGACCTTTGATGCCAACACAGGGAACCATGATGTGGCGTCGGGGTCCACAGTCATCTACCT

GCAGCCAGAAGATGAGGTCTGGCTGGAGATCTTCTTCAATGACCAGAACGGCCTCTTCTCAGATCCAGGCTGGGCAGACAGCTTGTTCTCTGGGTTTCTC

CTCTATGTCGATACAGATTACCTGGATTCTATATCAGAGGATGATGAGCTGTGATCCAGACCACTACAGGCCTGAATGTTGCAAACATGAGTACCACAGT

GGCTGACACTCTAATCTGGAGTGCTGGAAGGTGGAGCAAGTGATACGGGGATTCAGAAAACGTTTTTTACAGACGACTCTGGCTGAGTTATCAAAATAAG

ACAAACCACCAACTAGCTGAAATCACAACAAAACGAATGGCATACAATAACCTCAGACATGGACCCCCTAAAGTAATGATCCTAAATATTGAAGCAAATT

AAAGCAAATGATGTTAACAAATTTGAATGCCCTTGGCAATACAACCAGCTGGAAATGACACTGCCTCATTAAATATTCATAAAACCCCA
Translation
 MIVLLYVTSLAICASGQPRANQAKGESYSPRYICSIPGLPGPPGPPGANGSPGPHGRIGLPGRDGRDGRKGEKGEKGTAG - UNI35701 - GLKGK

TGPLGLAGEKGDQGETGKKGPIGPEGEKGEVGPAGPPGPKGDRGDQGDPGLPGVCRCGSIVLKSAFSVGITTSYPEERLPIIFNKVLFNEGEHYNPATGK

FICAFPGIYYFSYDITLANKHLAIGLVHNGQYRIRTFDANTGNHDVASGSTVIYLQPEDEVWLEIFFNDQNGLFSDPGWADSLFSGFLLYVDTDYLDSIS

EDDEL
Transcript ENSMUST00000076939
Sequence
TTCACATCTGCCTCCGTCTGGGGTTTGCAGAAGAACCTTGCCCACTCCTCCTCATTCCTAACGAGTGTATATAGTAAACTCTTTGAAATGTGAGTATTAT

GGGAAGGATCGCAGTTGCTTTAAATTATAGAAGTTGGCAAGTGCCTGGGAGAAGGAGTGGGAGGTTGTTTAAACTGAGAAAGACGGTTGCAGAACTTCGT

ACGACAGCATGAGCTCGCGCTCCGCACACATCCTTTATTTTTCTTCAAGACACTTCTCTGCATTGTTGTGGAGCAGCTTGGGTAATAACCATATTTCTGC

TCTGAATAGTTTTTAATGGTTTCTAAATTCATGGGAGTGTCAAAGCAAGGAAGTCTCATGTTTGGGAAGGACATCTGAACCCAGCAATGCCCAGGAAAG 

- UNI36115 - AGCCCAAGATGATTGTCCTGCTCTACGTGACGAGTCTTGCCATCTGTGCAAGTGGACAACCTCGGGCCAATCAGGCTAAGGGAGAGA

GCTACTCTCCAAGGTACATCTGCAGCATCCCTGGATTACCTGGGCCCCCAGGTCCTCCTGGAGCAAATGGCTCCCCTGGACCCCATGGTCGCATTGGCCT

TCCTGGAAGGGATGGTAGAGATGGCAGAAAAGGAGAGAAGGGGGAAAAGGGCACTGCAG - UNI35701 - GTCTAAAAGGTAAAACTGGACCCCTGG

GCCTTGCTGGTGAGAAAGGAGACCAAGGAGAAACTGGAAAGAAAGGACCCATAGGACCAGAGGGTGAGAAAGGAGAAGTCGGTCCAGCTGGGCCTCCTGG

GCCAAAGGGAGACAGAGGAGATCAAGGGGACCCAGGGCTGCCTGGAGTGTGCAGGTGTGGAAGCATTGTGCTCAAATCTGCCTTTTCAGTTGGCATCACA

ACCAGCTACCCAGAAGAAAGACTACCCATCATATTTAACAAAGTCCTCTTCAATGAGGGGGAGCATTACAACCCTGCAACGGGGAAGTTCATTTGCGCTT

TCCCAGGGATCTATTACTTTTCTTATGACATCACGTTGGCCAATAAGCACCTAGCAATCGGGCTGGTGCACAATGGGCAGTACCGGATAAGGACCTTTGA

TGCCAACACAGGGAACCATGATGTGGCGTCGGGGTCCACAGTCATCTACCTGCAGCCAGAAGATGAGGTCTGGCTGGAGATCTTCTTCAATGACCAGAAC

GGCCTCTTCTCAGATCCAGGCTGGGCAGACAGCTTGTTCTCTGGGTTTCTCCTCTATGTCGATACAGATTACCTGGATTCTATATCAGAGGATGATGAGC

TGTGATCCAGACCACTACAGGCCTGAATGTTGCAAACATGAGTACCACAGTGGCTGACACTCTAATCTGGAGTGCTGGAAGGTGGAGCAAGTGATACGGG

GATTCAGAAAACGTTTTTTACAGACGACTCTGGCTGAGTTATCAAAATAAGACAAACCACCAACTAGCTGAAATCACAACAAAACGAATGGCATACAATA

ACCTCAGACATGGACCCCCTAAAGTAATGATCCTAAATATTGAAGCAAATTAAAGCAAATGATGTTAACAAATTTGAATGCCCTTGGCAATACAACCAGC

TGGAAATGACACTGCCTCATTAAATATTCATAAAACCCCAGTTTTGTTTGTTATTTAGGACAGTCATAACATTACAGTGAAATTTGTTGACAATTCTCAA

GAGTCAAAAAAAAATAAGAGATGCTAAGAATTTTCTAACAAATTAAATAGTGACAAATTTCTTTTATTTATTCTTTTATGCTTATACATGTTCCAATAAC

TCTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTGTACACCAGAAGACATCAGCTGTCTCTCCTCAGATGCCATCCATCTT

GTTCTTTGAGCCAGAGAGTTCACTGAACCCGGAGCTCACTGATCTGGGTAGCCTGGCTGACTAGTGAGCCCGGAAGCTTCCTGTTCCTATCTCTCCAGCA

CAAAGATTACAAGCGTGTGCCACCATGCCTGCCTTGTATTCATATGGGTTCTGAAGGATCAAGCTCAGGTCCTCATGCTTACAAAGCACACACTCTGGAC

TGTGCTGTCACCCCAGCCGTCCGCAGCTATCTAATGAGACTGTGTGGAGCAGACATTGAGTGCTGAACCAGACAGAGAAAGATGGCAGTAGCCTTATTTT

GTATAGGCTAGAGTGTGGAGAGCACTTTGACACAGTGGCATGAGATGATCACCATGGTAAATAGATCAAATCTATGCTAGAGACACGTAGACCGTGACTC

CTGCCTGGGGTTGGAAGCCAAAGATTTCTCACAGAGAAAAAGCACTAAGCATGCCAAAGTACAAGTGTTTCTATGGGTCCAACAGTTGCAGAGGAAAAAA

GGGTTCACATTCTGTAGTCTACACATCCCCTCTGACATGTCAGTGTTATTTTCAATTGAGAAGGAATGAAAGACAGAAAGAGGGAAGCCTGAGAAAGGAA

CTCAAGGTGGTGATTGGAGCAAAATAGTTTTCTAACACAAATATGTTTCTTCCAAACAAGGGTGCTACTTAAATTATGGGGGGAAAACATTTCTCACAAA

TTTCCCAGAGCTAGAATGCAGCAAAGCACATGTCCCAGATCCATGAGTAAGCTGGAGTGAAGATGAACAGGGAGGAACCTGAATATCAGGGCAAACTACT

ACCTTCCAAGCCTCTCACTTCCTTCAGCCATTTTTATTAGAGTTGGCATCAGCTGCCCACTGTGATTCCCTATTTAATCTCAGCCACCATGATTCTGTCT

TAAGTATCACTGCTGTGGTCTGCAGTAATGGCATTCTCTTGTCTTTCGCCCTATATCTTCTATGTGTCCTTCTCCTGTTCACTAAGGATTTCAGTGCCTA

CTATACATGAAACACCAGGCTGGATCCTGTGATAAAGAAGGAAAACCAAGATGAATGTAGTCTGGTCTAAGCCATCCGACTCCTAAGAAGACAAGAAATG

ATATGCATGCCCACACACCTATACACAAGTCCCAATGCTCTGAAAAAGAAAATGCTAAGTCCCAGGAGAGTGACTGTATTTATGGAATGGGTCCCAAAGT

GAGGCACTGCCATCATCAGAGGTGACGCAATGATCACACAGCCTGTGTATATGAAGTGCCCACCTTGTCCAATGTATTACTGTATTCTGCCTGCTGAACT

CTGTCTACTTCTTGCTCTCTGAATCAATCCATAGGCTCAGGGGCCAACAGCATCAAGAATAGACAAAAAAAGAAGAAAAGGTGGGTTTGAGATATTCACT

TATCTCTAGATAACAGCCACTGCTAGAATTCCAGGCTACAAAGCATAGCAAGCAGCCAACAGAAATACACAATAAAATATAGGCCATTTGAAACCAGGTG

AATTTCCTAAAGAAACTATGAAGACTGTCTTGACCCACAAGATTGTTGTATAATTAAAACTTTCTTCTAACTGTGTTCTTCTAACGCAATTTTGAGCAAG

GCCTTGTTAAATAGCTGAAGATAAGGTTGAGTTCTTGATTCTCTACTGAACAAGTATTGGGATTACAGGCATGCACGTCTATGCCCAGGTTCGTGGTGCT

GGGGATCAAAACCAGGGCTTTATCCGTGCCAGGCTAACAATCTACCAGCTGAGTCACAGTCCCATCCTAACAAAGGCATTTTGTCAACATCTTGTAAATG

ATTCTTCATTGCAAAATCCATTTCATGTAGTTTTTTTTAATGGAGTTTCTTTCCCTGGTTTTATGCCCAAGATGAATTTGATTTTAAGTTATTAGCAGGG

TGACGATGAGGGTCAGACAGCTGCTGTGGGAAATGAAAAGCAGGTTTCATATT
Translation
 - UNI36115 - MIVLLYVTSLAICASGQPRANQAKGESYSPRYICSIPGLPGPPGPPGANGSPGPHGRIGLPGRDGRDGRKGEKGEKGTAG - UNI

35701 - GLKGKTGPLGLAGEKGDQGETGKKGPIGPEGEKGEVGPAGPPGPKGDRGDQGDPGLPGVCRCGSIVLKSAFSVGITTSYPEERLPIIFNKVL

FNEGEHYNPATGKFICAFPGIYYFSYDITLANKHLAIGLVHNGQYRIRTFDANTGNHDVASGSTVIYLQPEDEVWLEIFFNDQNGLFSDPGWADSLFSGF

LLYVDTDYLDSISEDDEL

For any suggestions or comments, please send an email to unitrap@crg.es