Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000061559 (Wdr61)
Chromosomal location
Chr 9: 54562542 - 54582326 (-)
Description
WD repeat domain 61 Gene [Source:MGI (curated);Acc:Wdr61-004]
RefSeq_peptide
NP_075680.1 NP_001020547.1 NP_001020546.1 
UniGene
Mm.28437 
MGI
MGI:1917493 
Uniprot/SWISSPROT
Q9ERF3 
Uniprot/SPTREMBL
A0MNP4 Q8BKW0 Q9CWZ4 Q8BVQ0 
Human Ortholog
ENSG00000140395 (WDR61)
Omim not available
UniTrap UNI21287
Vector Insertion
Chr 9: 54579193 - 54579245
Public Clones not available
Private Clones OST335923 (lexicon) OST250892 (lexicon) OST177597 (lexicon) OST172173 (lexicon)
OST141942 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI38227
Vector Insertion
Chr 9: 54579193 - 54582290
Public Clones (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI23926
Vector Insertion
Chr 9: 54576083 - 54578440
Public Clones not available
Private Clones OST240284 (lexicon)
Severity of mutation (?) Insertion after 5% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000121204
Sequence
GTGCTCCACTGACGTCAGGCGTGCTGTGCGGCTGGCTGTACGGTGGTGAGTTGGTGTGCTGGGCAGAGTTGGGGAATGGTGGTCTTTGGTGCTGTTGCCT

ACTAGGGCGAGAGGGCGACTGAACCGGGAGAGTTGGAGGCCACCACAGCAG - UNI21287 - AACTGTCTGGCCTTTAGCGCTTCATCCTTGGTTAA

GGAAATGACCAACCAG - UNI21287 - TACAGTATTCTCTTCAAGCAAGAGCAAG - UNI23926 - CCCATGATGATGCCATATGGTCAGTTGC

CTGGGAGACAAACAAAAAGGAAAACATTGAAACAGTGGTCACAGGATCCCTGGATGACCTGGTGAAGGTCTGGAAATG GCGTGATGAGAGGCTGGAGCT

CCAGTGGAGCCTGGAGGGACATCAGCTCGGGGTGGTGTCTGTGGACATCAGCCACACTCTTCCCATTGCTGCATCCAGCTCTCTAGACGCTCATATTCGC

CTCTGGGACTTGGAAAATGGCAAACAGATGAAGTCTATAGATGCAGGACCAG TGGATGCCTGGACTTTGGCATTTTCTCCTGACTCCCAGTATCTGGCC

ACAGGAACTCACATGGGGAAAGTGAACATTTTTGGTGTGGAAAGTGGAAAAAAAGAATATTCTTTGGACACTAGAGGAAAATTCATCCTTAGTATTGCAT

AT AGTCCTGATGGGAAATACCTGGCCAGCGGAGCCATAGACGGAATCATCAATATTTTTGACATTGCAACTGGAAAGCTTTTGCATACGCTGGAAG GC

CATGCGATGCCCATTCGCTCCTTGACCTTTTCCCCTGACTCCCAGCTCCTTGTCACGGCTTCAGATGATGGCTACATCAAGATCTATGATGT ACAACAT

GCCAATTTGGCTGGCACACTGAGTGGCCATGCGTCCTGGGTGTTGAATGTTGCGTTCTGTCCTGATGACACTCACTTTGTCTCCAG TTCATCTGACAAA

AGTGTGAAGGTTTGGGATGTTGGAACAAGGACCTGTATTCACACCTTCTTTGATCACCAGGATCAG GTTTGGGGAGTAAAATATAATGGAAATGGATCA

AAAATTGTATCTGTTGGAGATGACCAGGAAATTCATGTCTATGACTGCCCAATTTAAACACCAGCATCCTCGGGGCTAGGGCCTCAGACTACACAGGGTT

GATCATGACATTCCTCAGATTTTTTGGCATACTTAAAGTACAGCATATATTGTAGAACTTTTGTAGATACAATATAAATTTTTCCTGTTTTATTGGAAAT

GTTCTTCATATTTTAATGTAAATAAAGCATTCTTAATGC
Translation
 - UNI21287 - MTNQ - UNI21287 - YSILFKQEQA - UNI23926 - AHDDAIWSVAWETNKKENIETVVTGSLDDLVKVWKW WRDERLE

LQWSLEGHQLGVVSVDISHTLPIAASSSLDAHIRLWDLENGKQMKSIDAGPV VDAWTLAFSPDSQYLATGTHMGKVNIFGVESGKKEYSLDTRGKFILS

IAY SPDGKYLASGAIDGIINIFDIATGKLLHTLEG GHAMPIRSLTFSPDSQLLVTASDDGYIKIYDV VQHANLAGTLSGHASWVLNVAFCPDDTHFV

SS SSSDKSVKVWDVGTRTCIHTFFDHQDQ VWGVKYNGNGSKIVSVGDDQEIHVYDCPI
Transcript ENSMUST00000051822
Sequence
GACGTCAGGCGTGCTGTGCGGCTGGCTGTACGGTG - UNI21287 - AACTGTCTGGCCTTTAGCGCTTCATCCTTGGTTAAGGAAATGACCAACCAG

 - UNI21287 - TACAGTATTCTCTTCAAGCAAGAGCAAG - UNI23926 - CCCATGATGATGCCATATGGTCAGTTGCCTGGGAGACAAACAAA

AAGGAAAACATTGAAACAGTGGTCACAGGATCCCTGGATGACCTGGTGAAGGTCTGGAAATG GCGTGATGAGAGGCTGGAGCTCCAGTGGAGCCTGGAG

GGACATCAGCTCGGGGTGGTGTCTGTGGACATCAGCCACACTCTTCCCATTGCTGCATCCAGCTCTCTAGACGCTCATATTCGCCTCTGGGACTTGGAAA

ATGGCAAACAGATGAAGTCTATAGATGCAGGACCAG TGGATGCCTGGACTTTGGCATTTTCTCCTGACTCCCAGTATCTGGCCACAGGAACTCACATGG

GGAAAGTGAACATTTTTGGTGTGGAAAGTGGAAAAAAAGAATATTCTTTGGACACTAGAGGAAAATTCATCCTTAGTATTGCATAT AGTCCTGATGGGA

AATACCTGGCCAGCGGAGCCATAGACGGAATCATCAATATTTTTGACATTGCAACTGGAAAGCTTTTGCATACGCTGGAAG GCCATGCGATGCCCATTC

GCTCCTTGACCTTTTCCCCTGACTCCCAGCTCCTTGTCACGGCTTCAGATGATGGCTACATCAAGATCTATGATGT ACAACATGCCAATTTGGCTGGCA

CACTGAGTGGCCATGCGTCCTGGGTGTTGAATGTTGCGTTCTGTCCTGATGACACTCACTTTGTCTCCAG TTCATCTGACAAAAGTGTGAAGGTTTGGG

ATGTTGGAACAAGGACCTGTATTCACACCTTCTTTGATCACCAGGATCAG GTTTGGGGAGTAAAATATAATGGAAATGGATCAAAAATTGTATCTGTTG

GAGATGACCAGGAAATTCATGTCTATGACTGCCCAATTTAAACACCAGCATCCTCGGGGCTAGGGCCTCAGACTACACAGGGTTGATCATGACATTCCTC

AGATTTTTTGGCATACTTAAAGTACAGCATATATTGTAGAACTTTTGTAGATACAATATAAATTTTTCCTGTTTTATTGGAAATGTTCTTCATATTTTAA

TGTAAATAAAGCATTCTTAATGC
Translation
 - UNI21287 - MTNQ - UNI21287 - YSILFKQEQA - UNI23926 - AHDDAIWSVAWETNKKENIETVVTGSLDDLVKVWKW WRDERLE

LQWSLEGHQLGVVSVDISHTLPIAASSSLDAHIRLWDLENGKQMKSIDAGPV VDAWTLAFSPDSQYLATGTHMGKVNIFGVESGKKEYSLDTRGKFILS

IAY SPDGKYLASGAIDGIINIFDIATGKLLHTLEG GHAMPIRSLTFSPDSQLLVTASDDGYIKIYDV VQHANLAGTLSGHASWVLNVAFCPDDTHFV

SS SSSDKSVKVWDVGTRTCIHTFFDHQDQ VWGVKYNGNGSKIVSVGDDQEIHVYDCPI
Transcript ENSMUST00000118771
Sequence
GTACGGTGGTGAGTTGGTGTGCTGGGCAGAGTTGGGGAATGGTGGTCTTTGGTGCTGTTGCCTACTAGGGCGAGAGGGCGACTGAACCGGGAGAGTTGGA

GGCCACCACAGCAG - UNI21287 - AACTGTCTGGCCTTTAGCGCTTCATCCTTGGTTAAGGAAATGACCAACCAG - UNI21287 - TACAGTA

TTCTCTTCAAGCAAGAGCAAG - UNI23926 - CCCATGATGATGCCATATGGTCAGTTGCCTGGGAGACAAACAAAAAGGAAAACATTGAAACAGTG

GTCACAGGATCCCTGGATGACCTGGTGAAGGTCTGGAAATG GCGTGATGAGAGGCTGGAGCTCCAGTGGAGCCTGGAGGGACATCAGCTCGGGGTGGTG

TCTGTGGACATCAGCCACACTCTTCCCATTGCTGCATCCAGCTCTCTAGACGCTCATATTCGCCTCTGGGACTTGGAAAATGGCAAACAGATGAAGTCTA

TAGATGCAGGACCAG TGGATGCCTGGACTTTGGCATTTTCTCCTGACTCCCAGTATCTGGCCACAGGAACTCACATGGGGAAAGTGAACATTTTTGGTG

TGGAAAGTGGAAAAAAAGAATATTCTTTGGACACTAGAGGAAAATTCATCCTTAGTATTGCATAT AGTCCTGATGGGAAATACCTGGCCAGCGGAGCCA

TAGACGGAATCATCAATATTTTTGACATTGCAACTGGAAAGCTTTTGCATACGCTGGAAG GCCATGCGATGCCCATTCGCTCCTTGACCTTTTCCCCTG

ACTCCCAGCTCCTTGTCACGGCTTCAGATGATGGCTACATCAAGATCTATGATGT ACAACATGCCAATTTGGCTGGCACACTGAGTGGCCATGCGTCCT

GGGTGTTGAATGTTGCGTTCTGTCCTGATGACACTCACTTTGTCTCCAG TTCATCTGACAAAAGTGTGAAGGTTTGGGATGTTGGAACAAGGACCTGTA

TTCACACCTTCTTTGATCACCAGGATCAG GAGAGCAATTGACGGTTAGTGAAGGAGAGTGCCTGCCTGAGAGCGGAGATCCAGGTGCTCACTGGGTAGA

AAGGCAGCTCTCTGTTCCCAGGTGATACCAGCCTATTTCAGAATGGAGTTCTGAAGGAAACAGGCTGAGTGCACTGGAACTTGGTGTCATCCTACCTGCC

TGAGCATCCCTCCATGTGTCTATTTACAATGCCCCCTTTACCACACCCTCTCTCCCTGTTCTTTTTAGAGAGGTCTGACCTACTGGCAGCCTGCCTTAGC

CCTTGTGGGCTCAAGACTAGTGGACAGGGCTAAACACTGCTGTGCCTCAGACTGAGTTCCAGCACCTTAGGTCTTCTCTGCAGTCACCTCTGGACTGGGT

CTGCATGGTAATGGGGAAGGTTTCAGACATTAACATCCTAGTGCTTGTTGCTTCTTACTGAAACTCTGTGCCTGGCCACATTGTGCCTGTCCTCAGGCCT

AGCTCCTTAGAATAGTCCAGGCTGGTTTCCCACCTCCCTTGCTCACTCCCCTGTAGCTACACTGTCCTTTTTCCCTGGCCTCAGTGTCTCTTCCTCAGAC

AGGTCTACACCCTCACAGTTCAGAGGCTCTACAGATGGCAGCGTCTCAGAGTCCTTGTTCCCCATCCCCTTCTGCTCTTCCCCACTACTCCAGCTCTCTA

CTGTCCTTCACTCCGATTGGATCGCTGCATTCATCCCAAGTCAGAGTTCCCCAAGAGAAAGCTTATTCTATCAACCAGTGTGAGATAGTCTAGCACGTTA

CCCTGTTAAGTGCTAAGAAAAGAAAAAGCAAAGCCATTTGTCTCATACCAGTTCAATTTTAATTTTAAAGTGGAAAGTGTACAGGTGGGACAGTTAAGCA

ACACTCTGTAGATTCATAACAAAGAGCTGAGTCTAGTTTTATCCTACACAAGCTAAGTAGTAGCTCTCCAACAGTGATTTATTTGTAAGTCACAGCACAG

AAACACCACCCTGGAGTTGTGGTCCACTTATTAATTGGAGGAAGCAGTTTTAAGTCTGTCATGGCCTGTGGTCAAAGTGAGCACTGTACTTTGAAAACGT

ATGTTTTACTAGCCAGCAGTGTTCTTCAGGAGCCTGGTCCTGCTAGCTGGCTTACTTGACCAGCCACAGGTCTCATCTGCCCTTTGACCGCCCCCAGGAG

AGGTTCCTGGTCTGTGTCAAAGTCTGGTACCATAAAAACCAAGTAAGGATGGATCTGACAGGTTATCCCAGCAGCTTATAAAGCAGGGTTTTTAACTTCA

TTTGTAGAAAAGAAGGGAGAGGTTACGGCTAGAGGCTGAGGTAGCCTTTATTTAAAGTGCAGTCTACTTGCCAGGAATAAAGTAGTAACTAGAACACATT

CCCAAGCAGCTGTCATTGCCAGCCAACTAGAACCTGGTTGGGCCAGTTCTCACCACACATCACAAGCAGAAAGCCCTTTGCAGTATGGCTGTACAGTGAG

AATGACGGGCCTTTAGGAAGGAGATAATACTGAGGGGTCTGTGCCATTGCACACCCTTAAGACGTTAAGCTGGTGTGCTGGGAACTAAGCCACCAGCACT

CCCCTTTGGTTGTTTCTGCAGCTGGTCAGGGCTGCCAGGGATACATATGAAGGGCTTAGCTTTCCTTAGGGAAAGAAAGCACTTTGGTGGGACAACACTG

CAAAGGTCGTCAATAGATGATCATTAAGAGCACAAAGAACAAGGTATGGGGTTACAGGCAAATGGCTTTATTGGCTTATTTAAAATGGGCTTGTCATCAC

AAGGCTTGGGAAGTTCAGAAAACTTCCAAAAGAGATGTTCAAACAACCCCCTTTCTAACCAGTCAAGGGGAAAGAACATTATGCCCTAGACTGTCTCTGC

AGCTTTTGAGTCCAGCCTACTCTGTATGAACCAGGCATGCTGGGCCTACTGCAAGCCATATGTGGACTTTTACTATCTTAAGAGTTCTAGAGTCTAGATT

CAGAAATGTTACTACCAGACCTGAGCTCATACCCTTGGTGACTCTGCCAAGGGAGGAAGGGGAGAAAAACCACAGACTAGAGATGGGCCAGACACCCACC

TTCTGGGCCTTTGTTAGGGGCCAAGAGTGGTCCTCTGGGCCTACTGTGGGAACGAACCATGGCGAAGCCACTAAGAAGCACAAAAGGTCAGTGTGGTACT

GGCATCTCCAAAATAAGTCCTGAAAGTACAAATGAAACAGATTCCATATGCAGACTAGAGGGGATTGAACTTAAAACATTTAAATATAAATCAAGCTATA

ACTTAAGTTACAACTAGAAGAGAAACAAGAAAACCCAAGAGATACTCAGCAGTGGAGACTGCTGAACACATACACGGGACACCCCAAACGTGAGGCTATT

AAAGCGATGCCATTTTCATTG
Translation
 - UNI21287 - MTNQ - UNI21287 - YSILFKQEQA - UNI23926 - AHDDAIWSVAWETNKKENIETVVTGSLDDLVKVWKW WRDERLE

LQWSLEGHQLGVVSVDISHTLPIAASSSLDAHIRLWDLENGKQMKSIDAGPV VDAWTLAFSPDSQYLATGTHMGKVNIFGVESGKKEYSLDTRGKFILS

IAY SPDGKYLASGAIDGIINIFDIATGKLLHTLEG GHAMPIRSLTFSPDSQLLVTASDDGYIKIYDV VQHANLAGTLSGHASWVLNVAFCPDDTHFV

SS SSSDKSVKVWDVGTRTCIHTFFDHQDQ ESN

For any suggestions or comments, please send an email to unitrap@crg.es