Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000061589 (Dot1l)
Chromosomal location
Chr 10: 80217951 - 80257136 (+)
Description
DOT1-like, histone H3 methyltransferase (S. cerevisiae) Gene [Source:MGI (curated);Acc:Dot1l-001]
RefSeq_dna
NM_199322 
RefSeq_peptide
NP_955354.1 
UniGene
Mm.469689 Mm.410744 
MGI
MGI:2143886 
Uniprot/SPTREMBL
Q679P4 Q5YL88 Q679P5 Q6XZL7 Q6XZL8 
Human Ortholog
ENSG00000104885 (DOT1L)
Omim not available
UniTrap UNI1589
Vector Insertion
Chr 10: 80218270 - 80227346
Public Clones CC0034 (sanger) D148A05 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI26728
Vector Insertion
Chr 10: 80227391 - 80228907
Public Clones (sanger) IST10043H8 (tigm)
Private Clones OST100784 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4521
Vector Insertion
Chr 10: 80228983 - 80231349
Public Clones XR0979 (sanger) (sanger) P105E10 (ggtc) E130F10 (ggtc) E113G11 (ggtc)
IST14238F9 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI37693
Vector Insertion
Chr 10: 80231414 - 80233882
Public Clones (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11824
Vector Insertion
Chr 10: 80234112 - 80235848
Public Clones W011E12 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1015
Vector Insertion
Chr 10: 80243587 - 80243657
Public Clones AZ0006 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 4% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI603
Vector Insertion
Chr 10: 80244930 - 80245928
Public Clones AZ0014 (sanger) RRR032 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI12424
Vector Insertion
Chr 10: 80246617 - 80246732
Public Clones A029A06 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI6411
Vector Insertion
Chr 10: 80254307 - 80254887
Public Clones CSA004 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 84% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI2414
Vector Insertion
Chr 10: 80254887 - 80255484
Public Clones AC0506 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 84% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI17986
Vector Insertion
Chr 10: 80256251 - 80257093
Public Clones not available
Private Clones OST432449 (lexicon) OST423536 (lexicon)
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000092291
Sequence
GTGCCTTCTCCTCACGCCGGCCCAAGATGGCGGCGGCTCTAGACGCCCCGGCTCTGTGACTCCTACAAAGAGGGGAGCTGGGGCCACACGGGAGCGGCGG

CCGAGGCACAGGCCGGGCCGTCTGTCCTCAGCCGTCCGCCCCGCGTCCGCCCGTGTCCGCCCGCCCGGCTTCCCGCCGGTGGCCCCGCCCCTCCCCCAAC

CGCCCGCCTAGCATGGTGCGGCGGCCGCGCGCGCCGACATGGGCGAGAAGCTGGAGCTGAGGCTCAAGTCGCCTGTGGGCGCCGAGCCCGCCGTCTACCC

GTGGCCGCTGCCGGTCTAC - UNI1589 - GACAAGCACCATGATGCTGCTCATGAGATTATTGAGACTATCCG - UNI26728 - GTGGGTCTGC

GAGGAAATCCCAGATCTCAAGCTGGCCATGGAGAACTATGTCCTGATCGACTACGACACCAAAAG - UNI4521 - TTTTGAAAGCATGCAGCGGCTG

TGTGACAAATACAACCGGGCCATCGACAGCATCCACCAGCTG TGGAAGGGCACTACACAGCCCATGAAGCTGAATACTCGGCCGTCCAATGGACTTCTG

CGGCACATCCTGCAGCAGGTATATAACCACTCTGTCACTGACCCGGAGAAGCTTAACAACTACGAGCCCTTCTCCCCTGAGGTGTATGGGGAGACCTCCT

TTGACCTGGTGGCCCAGATGATTGATGAGATCAAGATGACAGAGGATGACCTGTTTGTCGACCTGGGCAGTG - UNI11824 - GTGTGGGGCAGGTT

GTCCTTCAGGTTGCTGCGGCCACCAACTGCAAACATCACTACGGAGTGGAGAAAGCGGACATCCCAGCCAAGTACGCAGAG ACCATGGACCGAGAGTTC

AGGAAGTGGATGAAATGGTATGGAAAAAAGCATGCAGAATACACA CTGGAACGAGGTGACTTCCTCTCAGAGGAATGGAGGGAACGGATCGCCAACACG

AG TGTTATATTTGTGAATAACTTTGCCTTTGGTCCTGAGGTGGATCACCAGCTGAAGGAGCGATTCGCAAACATGAAGGAAG - UNI1015 - GCGG

CAGAATCGTATCCTCAAAGCCCTTTGCCCCTCTGAACTTCAGGATCAACAGCAGGAACTTGAGTG - UNI1015 - ACATTGGCACCATCATGCGTGT

GGTGGAGCTGTCGCCCCTGAAGGGCTCTGTGTCGTGGACTGGCAAGCCTGTCTCCTACTATCTGCACACCATTGACCGCACCATA CTTGAAAACTATTT

TTCTAGTCTGAAAAATCCAAAACTCAGG - UNI603 - GAGGAGCAGGAGGCAGCTAGGCGAAGACAGCAGCGAGAGAACAAGAGCAATGCGACCACG

CCCACCAAAGTCCCTGAGAGCAAAGCAGCTGCCACTGAGGCCCCCGCG GATTCTGGTGCTGAGGAAGAAAAATCAGGTGTGGCTACTGTCAAAAAGCCA

TCTCCCTCCAAAGCCCGGAAGAAGAAACTGAACAAGAAAGGGAGAAAGATGGCTGGCCGGAAACGTGGGCGGCCCAAGAAAATGAGTGCTGCCAGTGCCG

AACGCAAGTCTAAGAAGAGCCAAAGCACACTGGATCTCCTGCACTCTCCGCCCCCAGCCCCACCCTCAGCCTCACCCCAGG - UNI12424 - ATGCG

TACAGGGCACCTCACAGCCCATTCTACCAGCTACCTCCAAGCACGCAGCTGCACTCACCCAACCCACTGCTAGTGGCACCCACCCCACCTGCGCTGCAGA

AGCTTTTAG - UNI12424 - AGTCCTTCAGAATCCAGTACCTGCAGTTCCTGGCTTATACAAAGACCCCGCAGTACAAGGCTAACCTACAGCAGCTT

CTGGACCAGGAGAAG GAGAAGAACACACAGCTCCTGGGCACAGCCCAGCAGCTCTTCGGCCATTGCCAGGCCCAAAAGGAAGAAATCCGCAGGCTGTTC

CAGCAGAAGCTGGATGAG TTGGGCGTGAAGGCGCTGACCTACAATGACCTGATTCAGGCCCAGAAGGAAATCTCTGCCCACAACCAGCAGCTGCGGGAA

CAGTCGGAACAGCTGGAGAAGGACAACAGCGAGCTTCGGAGCCAGAGCCTGCGGCTG CTCAGGGCCCGGTGTGAGGAGCTGAGGCTTGACTGGTCCACA

CTGTCCTTGGAGAACCTGCGGAAAGAGAAGCAGGCCCTGAGGAGCCAGATCTCAGAGAAGCAGCGGCACTGCCTGGAGCTGCAG ATCAGCATCGTGGAG

CTCGAGAAGACCCAGCGCCAGCAGGAGCTCCTGCAGTTAAAGTCCTGTGTACCACCAGATGATGCTTTGTCTTTGCATCTGCGTGGCAAGGGTGCCCTGG

GCCGAGAGCTGGAGGCTGATGCTGGGCGCTTACGCCTTGAGCTGGACTGTGCCAAGATCTCCCTGCCACACCTCAGCAGCATGAGCCCTGAGCTGTCCAT

GAACGGCCATGCTGCCAGCTATGAGCTCTGCAATGCAGCTAGTCGGCCATCATCCAAGCAGAACACACCCCAGTACCTGGCCTCTCCCTTGGACCAGGAG

GTCGTACCTTGTACCCCTAGCCACAGTGGCCGGCCTCGGCTAGAAAAGCTGTCTGGCCTGGCTTTGCCTGATTACACCCGGTTGTCACCTGCCAAGATTG

TGTTGAGGCGGCACCTGAGCCAGGACCACACTGGGGCTAGCAAAGCAGCTACCAGTGAGCCACACCCTCG GCCAGAGCACCCCAAGGAGAGCAGCCTTC

CCTACCAGAGCCCTGGCTTGTCCAACAGCATGAAGCTCAGCCCCCAGGATCCACCACTGGCCTCCCCGGCAACCTCGCCCCTCACCTCCGAGAAAGGTAG

TGAGAAG GGTGTGAAGGAGCGTGCCTACAGCAGCCACGGGGAGACCATCACCAGCCTACCTGTTAGCATTCCACTCAGCACAGTGCAGCCCAACAAGCT

GCCGGTCAGCATCCCACTGGCCAGCGTGGTGCTGCCCAGCCGTGCTGAGAGGGCG AGGAGCACTCCCAGCCCTGTGCCACAGCCCCGGGACTCTTCAGC

CACACTTGAGAAGCAGACTGGTGCTTCTGCCCATGGTGCAGGGGGTGCTGGAGCAGGAAGCAGGAGCCTCGCTGTGGCGCCCACAG GTTTCTATGCTGG

TTCGGTGGCCATCAGTGGGGCCCTGGCCAGCAGCCCAGCACCTCTGGCCTCTGGAATGGAATCTGCTGTTTTTGATGAATCCTCTGGCCCCAGCAGCCTC

TTTGCCACCATGGGGTCTCGCAGCACACCACCACAACACCCACCTCTCCTGTCGCAGTCCCGCAACTCGGGTCCTGCCTCTCCTGCCCACCAACTCACAG

CCAGTCCCCGCCTGAGTGTGACCACTCAGGGCTCGCTGCCAGACACCAGCAAAGGGGAACTGCCTTCTGATCCTGCCTTCTCAGACCCAGAGAGCGAAGC

AAAAAGGAGGATTGTGTTCAGCATTTCAGTTGGTGCCAGCTCCAAGCAGTCACCTTCCACCAGGCATAGCCCCTTGACTTCTGGCACCCGAGGGGACTGT

GTGCAGAGCCACGGACAGGACAGTCGTAAGCGCAGCAGAAGGAAGCGTGCATCAGCTGGAACACCTAGCCTCAGCACGGGTGTGTCCCCCAAGCGCCGGG

CTCTGCCAACTGTTGCTGGCCTCTTTACACAGTCCTCGGGGTCTCCTCTTAATCTCAACTCCATG GTCAGCAACATCAACCAGCCACTGGAGATCACAG

CCATCTCATCCCCTGAGAGCTCCCTGAAGAGCTCCCCCACCCCATACCAGGACCATGACCAGCCTCCGGTGCTCAGGAAGGAACGGCCTCTAGGACTAAC

TAATGGGGCCCACTACTCGCCACTGACCTCAGATGAGGAGCCAGGCTCTGAGGATGAGCCCAGCAGTGCCCG AATTGAGAGAAAAATTGCAACAATCTC

TTTAGAAAGCAAATCTCCCCCGAAGACACTGGAAAATG GTGGTGGCTTGGTGGGAAGGAAGTCAGCCCCTTCGAGCGAGCCTATCAACAGCAGCAAATG

GAAGTCTACCTTCTCTCCTATCTCTGACCTCGGCTTGGCCAAGGCTGTGGACAGTCCGCTACAGGCTGGCTCTGCCCTGAGCCACAGCCCCCTGTTCTCT

TTCCGGCCGTCCCTGGAGGAGCCTGCTGCTGAGGCCAAGCTCCCCACTCACCCAAGGAAAAGCTTTGCGGGCTCTCTGGGTGCAGCCGAGGGGCCAAGCC

CTGGCACCAACCCTCCCAACGGCCTGGCCTTCAGTGGGGGCCTTGCTGCAGACCTCGGTTTACACAGCTTCAATGATGGTGCTTCCCTCTCCCACAAGGG

CCCGGATGTGACTGGCCTGAGTGCCTCCCTGAGCTTCCCATCCCAGAGGGGCAAGGACAGTACCACAGAGGCCAACCCTTTCCTCAGCAGGCGGCAGCCC

GAGGGCCTGGGTGGCTTGAAGGGTGAGGGCAACGCAAACAAGGAGTCAGGAGAGAGCCTGCCCCTGTGCGGGCCCTCGGACAAGGCCTCACTGCCACATG

GCAGCAGGGCCAGCAAAGGTCGTGACCGTGAGCTGGACTTCAAGGGCGGCCACAACCTCTTCATCTCTGCTGCAGCCGTGCCTCCAGGTGGCCTCCTTGG

TGGCCCTGGTCTTGTAACTGTGGCTTCTTCTGCGGGCAGTGCAACACCCACTGCCCAGGCTCCCCGGCCTTTCCTGAGCACCTTTGCCCCCGGGCCCCAG

TTTACTCTGGGCCCCATGTCCCTGCAGGCCAACCTGGGCTCTGTGGCCGGCTCCTCTGTGCTGCAGTCCTTGTTCAGCACTGTGCCAGCTGCTGCAGGCC

TGGTGCATGTGTCGTCCACTGCGACCCGATTGACCAACTCACACACCATGGGCAGCTTCTCTTCTGGGGTGGCCGGCGGAACCGTTGGAG - UNI2414

 - - UNI6411 - GTGTCTTTACCCACGCGGTGCCCTCCGCCTCTGCTCACCCGTTTGGAGCTGGTGTCGGCAGCGGGGCTGTGTGTAGCAGTGCCAC

GCTGGGCCTGAGCCCGCTGCAGGCGGCGGCCAGCACCTCGGCTTCTTCCTTTCAGGCCGCGGCTTCGGTCGAGACTCGGCCGCCCCCTCCACCTCCCCTA

CTTCCTCCTCAGCATCTAGGCCGGCCCCCTGCGGGGCCACCTGTCCTCCATGCACCCCCTCCTCCTAACGTCGCCTTGCCTCCTCCACCTGCGCTGCTGG

CTTCTAACCCTGAGCCAGTGCTTCTGCAGAGCCTGGCCTCCCTCCCAGCTAACAACGCTTTCTTACCCCCCTCCTCTGCCGCCTCTCTGCAGCCTGCTAA

TGCCTCTCTGTCTGTCAAGCTCGCCTCCCTCCCACACAAGGTCTCCCGCCCCTCCTTCACGGTGCACCACCAGCCCCTGCCCCGGCTGGCCCTGGCGCAG

GCCGCGCCCGCCGCCCCACAGGCCAGCACCTCGGGGCCATCTGCTGTGTGGGTTTCCCTTGGCATGCCGCCTCCTTATGCCGCGCACCTTTCGGGGGTTA

AGCCTCGATAA
Translation
 - UNI1589 -  - UNI26728 -  - UNI4521 -   - UNI11824 -     - UNI1015 -  - UNI1015 -   - UNI603 -   -

 UNI12424 -  - UNI12424 -            MSLQANLGSVAGSSVLQSLFSTVPAAAGLVHVSSTATRLTNSHTMGSFSSGVAGGTVGG - U

NI2414 - - UNI6411 - GVFTHAVPSASAHPFGAGVGSGAVCSSATLGLSPLQAAASTSASSFQAAASVETRPPPPPPLLPPQHLGRPPAGPPVLH

APPPPNVALPPPPALLASNPEPVLLQSLASLPANNAFLPPSSAASLQPANASLSVKLASLPHKVSRPSFTVHHQPLPRLALAQAAPAAPQASTSGPSAVW

VSLGMPPPYAAHLSGVKPR
Transcript ENSMUST00000092292
Sequence
GACTATACT CTGGAACGAGGTGACTTCCTCTCAGAGGAATGGAGGGAACGGATCGCCAACACGAG TGTTATATTTGTGAATAACTTTGCCTTTGGTCC

TGAGGTGGATCACCAGCTGAAGGAGCGATTCGCAAACATGAAGGAAG - UNI1015 - GCGGCAGAATCGTATCCTCAAAGCCCTTTGCCCCTCTGAA

CTTCAGGATCAACAGCAGGAACTTGAGTG - UNI1015 - ACATTGGCACCATCATGCGTGTGGTGGAGCTGTCGCCCCTGAAGGGCTCTGTGTCGTG

GACTGGCAAGCCTGTCTCCTACTATCTGCACACCATTGACCGCACCATA CTTGAAAACTATTTTTCTAGTCTGAAAAATCCAAAACTCAGG - UNI60

3 - GAGGAGCAGGAGGCAGCTAGGCGAAGACAGCAGCGAGAGAACAAGAGCAATGCGACCACGCCCACCAAAGTCCCTGAGAGCAAAGCAGCTGCCACT

GAGGCCCCCGCG GATTCTGGTGCTGAGGAAGAAAAATCAGGTGTGGCTACTGTCAAAAAGCCATCTCCCTCCAAAGCCCGGAAGAAGAAACTGAACAAG

AAAGGGAGAAAGATGGCTGGCCGGAAACGTGGGCGGCCCAAGAAAATGAGTGCTGCCAGTGCCGAACGCAAGTCTAAGAAGAGCCAAAGCACACTGGATC

TCCTGCACTCTCCGCCCCCAGCCCCACCCTCAGCCTCACCCCAGG - UNI12424 - ATGCGTACAGGGCACCTCACAGCCCATTCTACCAGCTACCT

CCAAGCACGCAGCTGCACTCACCCAACCCACTGCTAGTGGCACCCACCCCACCTGCGCTGCAGAAGCTTTTAG - UNI12424 - AGTCCTTCAGAAT

CCAGTACCTGCAGTTCCTGGCTTATACAAAGACCCCGCAGTACAAGGCTAACCTACAGCAGCTTCTGGACCAGGAGAAG GAGAAGAACACACAGCTCCT

GGGCACAGCCCAGCAGCTCTTCGGCCATTGCCAGGCCCAAAAGGAAGAAATCCGCAGGCTGTTCCAGCAGAAGCTGGATGAG TTGGGCGTGAAGGCGCT

GACCTACAATGACCTGATTCAGGCCCAGAAGGAAATCTCTGCCCACAACCAGCAGCTGCGGGAACAGTCGGAACAGCTGGAGAAGGACAACAGCGAGCTT

CGGAGCCAGAGCCTGCGGCTG CTCAGGGCCCGGTGTGAGGAGCTGAGGCTTGACTGGTCCACACTGTCCTTGGAGAACCTGCGGAAAGAGAAGCAGGCC

CTGAGGAGCCAGATCTCAGAGAAGCAGCGGCACTGCCTGGAGCTGCAG ATCAGCATCGTGGAGCTCGAGAAGACCCAGCGCCAGCAGGAGCTCCTGCAG

TTAAAGTCCTGTGTACCACCAGATGATGCTTTGTCTTTGCATCTGCGTGGCAAGGGTGCCCTGGGCCGAGAGCTGGAGGCTGATGCTGGGCGCTTACGCC

TTGAGCTGGACTGTGCCAAGATCTCCCTGCCACACCTCAGCAGCATGAGCCCTGAGCTGTCCATGAACGGCCATGCTGCCAGCTATGAGCTCTGCAATGC

AGCTAGTCGGCCATCATCCAAGCAGAACACACCCCAGTACCTGGCCTCTCCCTTGGACCAGGAGGTCGTACCTTGTACCCCTAGCCACAGTGGCCGGCCT

CGGCTAGAAAAGCTGTCTGGCCTGGCTTTGCCTGATTACACCCGGTTGTCACCTGCCAAGATTGTGTTGAGGCGGCACCTGAGCCAGGACCACACTGGGG

CTAGCAAAGCAGCTACCAGTGAGCCACACCCTCG GCCAGAGCACCCCAAGGAGAGCAGCCTTCCCTACCAGAGCCCTGGCTTGTCCAACAGCATGAAGC

TCAGCCCCCAGGATCCACCACTGGCCTCCCCGGCAACCTCGCCCCTCACCTCCGAGAAAGGTAGTGAGAAG GGTGTGAAGGAGCGTGCCTACAGCAGCC

ACGGGGAGACCATCACCAGCCTACCTGTTAGCATTCCACTCAGCACAGTGCAGCCCAACAAGCTGCCGGTCAGCATCCCACTGGCCAGCGTGGTGCTGCC

CAGCCGTGCTGAGAGGGCG AGGAGCACTCCCAGCCCTGTGCCACAGCCCCGGGACTCTTCAGCCACACTTGAGAAGCAGACTGGTGCTTCTGCCCATGG

TGCAGGGGGTGCTGGAGCAGGAAGCAGGAGCCTCGCTGTGGCGCCCACAG GTTTCTATGCTGGTTCGGTGGCCATCAGTGGGGCCCTGGCCAGCAGCCC

AGCACCTCTGGCCTCTGGAATGGAATCTGCTGTTTTTGATGAATCCTCTGGCCCCAGCAGCCTCTTTGCCACCATGGGGTCTCGCAGCACACCACCACAA

CACCCACCTCTCCTGTCGCAGTCCCGCAACTCGGGTCCTGCCTCTCCTGCCCACCAACTCACAGCCAGTCCCCGCCTGAGTGTGACCACTCAGGGCTCGC

TGCCAGACACCAGCAAAGGGGAACTGCCTTCTGATCCTGCCTTCTCAGACCCAGAGAGCGAAGCAAAAAGGAGGATTGTGTTCAGCATTTCAGTTGGTGC

CAGCTCCAAGCAGTCACCTTCCACCAGGCATAGCCCCTTGACTTCTGGCACCCGAGGGGACTGTGTGCAGAGCCACGGACAGGACAGTCGTAAGCGCAGC

AGAAGGAAGCGTGCATCAGCTGGAACACCTAGCCTCAGCACGGGTGTGTCCCCCAAGCGCCGGGCTCTGCCAACTGTTGCTGGCCTCTTTACACAGTCCT

CGGGGTCTCCTCTTAATCTCAACTCCATG GTCAGCAACATCAACCAGCCACTGGAGATCACAGCCATCTCATCCCCTGAGAGCTCCCTGAAGAGCTCCC

CCACCCCATACCAGGACCATGACCAGCCTCCGGTGCTCAGGAAGGAACGGCCTCTAGGACTAACTAATGGGGCCCACTACTCGCCACTGACCTCAGATGA

GGAGCCAGGCTCTGAGGATGAGCCCAGCAGTGCCCG AATTGAGAGAAAAATTGCAACAATCTCTTTAGAAAGCAAATCTCCCCCGAAGACACTGGAAAA

TG - UNI2414 - - UNI6411 - GTGTCTTTACCCACGCGGTGCCCTCCGCCTCTGCTCACCCGTTTGGAGCTGGTGTCGGCAGCGGGGCTGTGTG

TAGCAGTGCCACGCTGGGCCTGAGCCCGCTGCAGGCGGCGGCCAGCACCTCGGCTTCTTCCTTTCAGGCCGCGGCTTCGGTCGAGACTCGGCCGCCCCCT

CCACCTCCCCTACTTCCTCCTCAGCATCTAGGCCGGCCCCCTGCGGGGCCACCTGTCCTCCATGCACCCCCTCCTCCTAACGTCGCCTTGCCTCCTCCAC

CTGCGCTGCTGGCTTCTAACCCTGAGCCAGTGCTTCTGCAGAGCCTGGCCTCCCTCCCAGCTAACAACGCTTTCTTACCCCCCTCCTCTGCCGCCTCTCT

GCAGCCTGCTAATGCCTCTCTGTCTGTCAAGCTCGCCTCCCTCCCACACAAGGTCTCCCGCCCCTCCTTCACGGTGCACCACCAGCCCCTGCCCCGGCTG

GCCCTGGCGCAGGCCGCGCCCGCCGCCCCACAGGCCAGCACCTCGGGGCCATCTGCTGTGTGGGTTTCCCTTGGCATGCCGCCTCCTTATGCCGCGCACC

TTTCGGGGGTTAAGCCTCGATAAAGACCTTGCTTAGCTAGCAGTTCATGTTCTGTAAG - UNI17986 - GTAATTAGGACTTCTACTACCTCAGCCA

CGACCTATGCAAGGACGGTGTGGACCAAGACTGCTGCCTGCCAGGCCGGCGGAGCCGGACATGGAGCCACTGTGAATCGGCGGCACCGCAGGAGGTGCTG

GACTGGTCCAGTTTGTACTGTCAATAGTTTTAGATAAAGTATTTATCTTTTTTTTTTTTTAAAGTATAAGCAATTCTGACTTACTTTATTCCATCAAAGT

CGTCCAAGGCAACCTCTTGAGACGTCTAAGTGTCTGTGAGAGAGAATAATATAAAGACTTGGCCTGCTGGGCTGGCCACAAGGACTCCTGACTCCGTCCC

GGTGCTATCTCACCAGCAAGCCCATGCCTGCCCATCTCCACCTCTGTCCTGGGTGCTGCCCCAAACATGGACTGTGGCCAAACAGTTCTCAGATGCGCCC

CCAACATCTTGCTCTGACACCAAAGGCATGCCTGGCATGCCCAATGGGGGCTGACCTTTGTTCCCCCTCCTTGGAACTTGCCTGCTGTCACTGTGAACAC

CCCACTGTTAACCCTGTGGCTTTGGGCGTGCCTTTGCAGTGGGTGCAGACTGGGCTGGGGCAGGAATGGGGGTTCCCAGCTGGGCTGAGTGGTGCTGACA

GGTGAGGGCCACTACTGCAGGGCTTGGTGGCTCCTGTGACAAGTGCATTTACTTTGTATTTCTTTGCTTTTCTGGCTCGGGGCATGCTGGTCAGGTGACA

TGGGGCTGGCCCAATGTGGGTCCCCTGGCATCTGTGTATAAGAGAGTCACATGATCAGTGACAGTATTTTATAGAGATTTGATGGAGATTTATAAATTTC

ATAGACTTGACTGCATTTATTTTTAGATTGTATAATGCACAGTGAACTTTAAAGAAA
Translation
DYT LERGDFLSEEWRERIANTS SVIFVNNFAFGPEVDHQLKERFANMKEG - UNI1015 - GGRIVSSKPFAPLNFRINSRNLSD - UNI1015 

- DIGTIMRVVELSPLKGSVSWTGKPVSYYLHTIDRTI LENYFSSLKNPKLR - UNI603 - EEQEAARRRQQRENKSNATTPTKVPESKAAATEAP

A DSGAEEEKSGVATVKKPSPSKARKKKLNKKGRKMAGRKRGRPKKMSAASAERKSKKSQSTLDLLHSPPPAPPSASPQD - UNI12424 - DAYRAP

HSPFYQLPPSTQLHSPNPLLVAPTPPALQKLLE - UNI12424 - ESFRIQYLQFLAYTKTPQYKANLQQLLDQEK EKNTQLLGTAQQLFGHCQAQK

EEIRRLFQQKLDE LGVKALTYNDLIQAQKEISAHNQQLREQSEQLEKDNSELRSQSLRL LRARCEELRLDWSTLSLENLRKEKQALRSQISEKQRHCL

ELQ ISIVELEKTQRQQELLQLKSCVPPDDALSLHLRGKGALGRELEADAGRLRLELDCAKISLPHLSSMSPELSMNGHAASYELCNAASRPSSKQNTPQ

YLASPLDQEVVPCTPSHSGRPRLEKLSGLALPDYTRLSPAKIVLRRHLSQDHTGASKAATSEPHPR RPEHPKESSLPYQSPGLSNSMKLSPQDPPLASP

ATSPLTSEKGSEK GVKERAYSSHGETITSLPVSIPLSTVQPNKLPVSIPLASVVLPSRAERA RSTPSPVPQPRDSSATLEKQTGASAHGAGGAGAGSR

SLAVAPTG GFYAGSVAISGALASSPAPLASGMESAVFDESSGPSSLFATMGSRSTPPQHPPLLSQSRNSGPASPAHQLTASPRLSVTTQGSLPDTSKGE

LPSDPAFSDPESEAKRRIVFSISVGASSKQSPSTRHSPLTSGTRGDCVQSHGQDSRKRSRRKRASAGTPSLSTGVSPKRRALPTVAGLFTQSSGSPLNLN

SM VSNINQPLEITAISSPESSLKSSPTPYQDHDQPPVLRKERPLGLTNGAHYSPLTSDEEPGSEDEPSSAR RIERKIATISLESKSPPKTLENG - U

NI2414 - - UNI6411 - GVFTHAVPSASAHPFGAGVGSGAVCSSATLGLSPLQAAASTSASSFQAAASVETRPPPPPPLLPPQHLGRPPAGPPVLH

APPPPNVALPPPPALLASNPEPVLLQSLASLPANNAFLPPSSAASLQPANASLSVKLASLPHKVSRPSFTVHHQPLPRLALAQAAPAAPQASTSGPSAVW

VSLGMPPPYAAHLSGVKPR - UNI17986 - 
Transcript ENSMUST00000105336
Sequence
GTGCCTTCTCCTCACGCCGGCCCAAGATGGCGGCGGCTCTAGACGCCCCGGCTCTGTGACTCCTACAAAGAGGGGAGCTGGGGCCACACGGGAGCGGCGG

CCGAGGCACAGGCCGGGCCGTCTGTCCTCAGCCGTCCGCCCCGCGTCCGCCCGTGTCCGCCCGCCCGGCTTCCCGCCGGTGGCCCCGCCCCTCCCCCAAC

CGCCCGCCTAGCATGGTGCGGCGGCCGCGCGCGCCGACATGGGCGAGAAGCTGGAGCTGAGGCTCAAGTCGCCTGTGGGCGCCGAGCCCGCCGTCTACCC

GTGGCCGCTGCCGGTCTAC - UNI1589 - GACAAGCACCATGATGCTGCTCATGAGATTATTGAGACTATCCG - UNI26728 - GTGGGTCTGC

GAGGAAATCCCAGATCTCAAGCTGGCCATGGAGAACTATGTCCTGATCGACTACGACACCAAAAG - UNI4521 - TTTTGAAAGCATGCAGCGGCTG

TGTGACAAATACAACCGGGCCATCGACAGCATCCACCAGCTG TGGAAGGGCACTACACAGCCCATGAAGCTGAATACTCGGCCGTCCAATGGACTTCTG

CGGCACATCCTGCAGCAGGTATATAACCACTCTGTCACTGACCCGGAGAAGCTTAACAACTACGAGCCCTTCTCCCCTGAGGTGTATGGGGAGACCTCCT

TTGACCTGGTGGCCCAGATGATTGATGAGATCAAGATGACAGAGGATGACCTGTTTGTCGACCTGGGCAGTG - UNI11824 - GTGTGGGGCAGGTT

GTCCTTCAGGTTGCTGCGGCCACCAACTGCAAACATCACTACGGAGTGGAGAAAGCGGACATCCCAGCCAAGTACGCAGAG ACCATGGACCGAGAGTTC

AGGAAGTGGATGAAATGGTATGGAAAAAAGCATGCAGAATACACA CTGGAACGAGGTGACTTCCTCTCAGAGGAATGGAGGGAACGGATCGCCAACACG

AG TGTTATATTTGTGAATAACTTTGCCTTTGGTCCTGAGGTGGATCACCAGCTGAAGGAGCGATTCGCAAACATGAAGGAAG - UNI1015 - GCGG

CAGAATCGTATCCTCAAAGCCCTTTGCCCCTCTGAACTTCAGGATCAACAGCAGGAACTTGAGTG - UNI1015 - ACATTGGCACCATCATGCGTGT

GGTGGAGCTGTCGCCCCTGAAGGGCTCTGTGTCGTGGACTGGCAAGCCTGTCTCCTACTATCTGCACACCATTGACCGCACCATA CTTGAAAACTATTT

TTCTAGTCTGAAAAATCCAAAACTCAGG - UNI603 - GAGGAGCAGGAGGCAGCTAGGCGAAGACAGCAGCGAGAGAACAAGAGCAATGCGACCACG

CCCACCAAAGTCCCTGAGAGCAAAGCAGCTGCCACTGAGGCCCCCGCG GATTCTGGTGCTGAGGAAGAAAAATCAGGTGTGGCTACTGTCAAAAAGCCA

TCTCCCTCCAAAGCCCGGAAGAAGAAACTGAACAAGAAAGGGAGAAAGATGGCTGGCCGGAAACGTGGGCGGCCCAAGAAAATGAGTGCTGCCAGTGCCG

AACGCAAGTCTAAGAAGAGCCAAAGCACACTGGATCTCCTGCACTCTCCGCCCCCAGCCCCACCCTCAGCCTCACCCCAGG - UNI12424 - ATGCG

TACAGGGCACCTCACAGCCCATTCTACCAGCTACCTCCAAGCACGCAGCTGCACTCACCCAACCCACTGCTAGTGGCACCCACCCCACCTGCGCTGCAGA

AGCTTTTAG - UNI12424 - AGTCCTTCAGAATCCAGTACCTGCAGTTCCTGGCTTATACAAAGACCCCGCAGTACAAGGCTAACCTACAGCAGCTT

CTGGACCAGGAGAAG GAGAAGAACACACAGCTCCTGGGCACAGCCCAGCAGCTCTTCGGCCATTGCCAGGCCCAAAAGGAAGAAATCCGCAGGCTGTTC

CAGCAGAAGCTGGATGAG TTGGGCGTGAAGGCGCTGACCTACAATGACCTGATTCAGGCCCAGAAGGAAATCTCTGCCCACAACCAGCAGCTGCGGGAA

CAGTCGGAACAGCTGGAGAAGGACAACAGCGAGCTTCGGAGCCAGAGCCTGCGGCTG CTCAGGGCCCGGTGTGAGGAGCTGAGGCTTGACTGGTCCACA

CTGTCCTTGGAGAACCTGCGGAAAGAGAAGCAGGCCCTGAGGAGCCAGATCTCAGAGAAGCAGCGGCACTGCCTGGAGCTGCAG ATCAGCATCGTGGAG

CTCGAGAAGACCCAGCGCCAGCAGGAGCTCCTGCAGTTAAAGTCCTGTGTACCACCAGATGATGCTTTGTCTTTGCATCTGCGTGGCAAGGGTGCCCTGG

GCCGAGAGCTGGAGGCTGATGCTGGGCGCTTACGCCTTGAGCTGGACTGTGCCAAGATCTCCCTGCCACACCTCAGCAGCATGAGCCCTGAGCTGTCCAT

GAACGGCCATGCTGCCAGCTATGAGCTCTGCAATGCAGCTAGTCGGCCATCATCCAAGCAGAACACACCCCAGTACCTGGCCTCTCCCTTGGACCAGGAG

GTCGTACCTTGTACCCCTAGCCACAGTGGCCGGCCTCGGCTAGAAAAGCTGTCTGGCCTGGCTTTGCCTGATTACACCCGGTTGTCACCTGCCAAGATTG

TGTTGAGGCGGCACCTGAGCCAGGACCACACTGGGGCTAGCAAAGCAGCTACCAGTGAGCCACACCCTCG GCCAGAGCACCCCAAGGAGAGCAGCCTTC

CCTACCAGAGCCCTGGCTTGTCCAACAGCATGAAGCTCAGCCCCCAGGATCCACCACTGGCCTCCCCGGCAACCTCGCCCCTCACCTCCGAGAAAGGTAG

TGAGAAG GGTGTGAAGGAGCGTGCCTACAGCAGCCACGGGGAGACCATCACCAGCCTACCTGTTAGCATTCCACTCAGCACAGTGCAGCCCAACAAGCT

GCCGGTCAGCATCCCACTGGCCAGCGTGGTGCTGCCCAGCCGTGCTGAGAGGGCG AGGAGCACTCCCAGCCCTGTGCCACAGCCCCGGGACTCTTCAGC

CACACTTGAGAAGCAGACTGGTGCTTCTGCCCATGGTGCAGGGGGTGCTGGAGCAGGAAGCAGGAGCCTCGCTGTGGCGCCCACAG GTTTCTATGCTGG

TTCGGTGGCCATCAGTGGGGCCCTGGCCAGCAGCCCAGCACCTCTGGCCTCTGGAATGGAATCTGCTGTTTTTGATGAATCCTCTGGCCCCAGCAGCCTC

TTTGCCACCATGGGGTCTCGCAGCACACCACCACAACACCCACCTCTCCTGTCGCAGTCCCGCAACTCGGGTCCTGCCTCTCCTGCCCACCAACTCACAG

CCAGTCCCCGCCTGAGTGTGACCACTCAGGGCTCGCTGCCAGACACCAGCAAAGGGGAACTGCCTTCTGATCCTGCCTTCTCAGACCCAGAGAGCGAAGC

AAAAAGGAGGATTGTGTTCAGCATTTCAGTTGGTGCCAGCTCCAAGCAGTCACCTTCCACCAGGCATAGCCCCTTGACTTCTGGCACCCGAGGGGACTGT

GTGCAGAGCCACGGACAGGACAGTCGTAAGCGCAGCAGAAGGAAGCGTGCATCAGCTGGAACACCTAGCCTCAGCACGGGTGTGTCCCCCAAGCGCCGGG

CTCTGCCAACTGTTGCTGGCCTCTTTACACAGTCCTCGGGGTCTCCTCTTAATCTCAACTCCATG GTCAGCAACATCAACCAGCCACTGGAGATCACAG

CCATCTCATCCCCTGAGAGCTCCCTGAAGAGCTCCCCCACCCCATACCAGGACCATGACCAGCCTCCGGTGCTCAGGAAGGAACGGCCTCTAGGACTAAC

TAATGGGGCCCACTACTCGCCACTGACCTCAGATGAGGAGCCAGGCTCTGAGGATGAGCCCAGCAGTGCCCG AATTGAGAGAAAAATTGCAACAATCTC

TTTAGAAAGCAAATCTCCCCCGAAGACACTGGAAAATG GTGGTGGCTTGGTGGGAAGGAAGTCAGCCCCTTCGAGCGAGCCTATCAACAGCAGCAAATG

GAAGTCTACCTTCTCTCCTATCTCTGACCTCGGCTTGGCCAAGGCTGTGGACAGTCCGCTACAGGCTGGCTCTGCCCTGAGCCACAGCCCCCTGTTCTCT

TTCCGGCCGTCCCTGGAGGAGCCTGCTGCTGAGGCCAAGCTCCCCACTCACCCAAGGAAAAGCTTTGCGGGCTCTCTGGGTGCAGCCGAGGGGCCAAGCC

CTGGCACCAACCCTCCCAACGGCCTGGCCTTCAGTGGGGGCCTTGCTGCAGACCTCGGTTTACACAGCTTCAATGATGGTGCTTCCCTCTCCCACAAGGG

CCCGGATGTGACTGGCCTGAGTGCCTCCCTGAGCTTCCCATCCCAGAGGGGCAAGGACAGTACCACAGAGGCCAACCCTTTCCTCAGCAGGCGGCAGCCC

GAGGGCCTGGGTGGCTTGAAGGGTGAGGGCAACGCAAACAAGGAGTCAGGAGAGAGCCTGCCCCTGTGCGGGCCCTCGGACAAGGCCTCACTGCCACATG

GCAGCAGGGCCAGCAAAGGTCGTGACCGTGAGCTGGACTTCAAGGGCGGCCACAACCTCTTCATCTCTGCTGCAGCCGTGCCTCCAGGTGGCCTCCTTGG

TGGCCCTGGTCTTGTAACTGTGGCTTCTTCTGCGGGCAGTGCAACACCCACTGCCCAGGCTCCCCGGCCTTTCCTGAGCACCTTTGCCCCCGGGCCCCAG

TTTACTCTGGGCCCCATGTCCCTGCAGGCCAACCTGGGCTCTGTGGCCGGCTCCTCTGTGCTGCAGTCCTTGTTCAGCACTGTGCCAGCTGCTGCAGGCC

TGGTGCATGTGTCGTCCACTGCGACCCGATTGACCAACTCACACACCATGGGCAGCTTCTCTTCTGGGGTGGCCGGCGGAACCGTTGGAG - UNI2414

 - - UNI6411 - - UNI17986 - GTAATTAGGACTTCTACTACCTCAGCCACGACCTATGCAAGGACGGTGTGGACCAAGACTGCTGCCTGCCAG

GCCGGCGGAGCCGGACATGGAGCCACTGTGAATCGGCGGCACCGCAGGAGGTGCTGGACTGGTCCAGTTTGTACTGTCAATAGTTTTAGATAAAGTATTT

ATCTTTTTTTTTTTTTAAAGTATAAGCAATTCTGACTTACTTTATTCCATCAAAGTCGTCCAAGGCAACCTCTTGAGACGTCTAAGTGTCTGTGAGAGAG

AATAATATAAAGACTTGGCCTGCTGGGCTGGCCACAAGGACTCCTGACTCCGTCCCGGTGCTATCTCACCAGCAAGCCCATGCCTGCCCATCTCCACCTC

TGTCCTGGGTGCTGCCCCAAACATGGACTGTGGCCAAACAGTTCTCAGATGCGCCCCCAACATCTTGCTCTGACACCAAAGGCATGCCTGGCATGCCCAA

TGGGGGCTGACCTTTGTTCCCCCTCCTTGGAACTTGCCTGCTGTCACTGTGAACACCCCACTGTTAACCCTGTGGCTTTGGGCGTGCCTTTGCAGTGGGT

GCAGACTGGGCTGGGGCAGGAATGGGGGTTCCCAGCTGGGCTGAGTGGTGCTGACAGGTGAGGGCCACTACTGCAGGGCTTGGTGGCTCCTGTGACAAGT

GCATTTACTTTGTATTTCTTTGCTTTTCTGGCTCGGGGCATGCTGGTCAGGTGACATGGGGCTGGCCCAATGTGGGTCCCCTGGCATCTGTGTATAAGAG

AGTCACATGATCAGTGACAGTATTTTATAGAGATTTGATGGAGATTTATAAATTTCATAGACTTGACTG
Translation
MGEKLELRLKSPVGAEPAVYPWPLPVY - UNI1589 - DKHHDAAHEIIETIR - UNI26728 - RWVCEEIPDLKLAMENYVLIDYDTKS - UN

I4521 - SFESMQRLCDKYNRAIDSIHQL WKGTTQPMKLNTRPSNGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTEDD

LFVDLGSG - UNI11824 - GVGQVVLQVAAATNCKHHYGVEKADIPAKYAE TMDREFRKWMKWYGKKHAEYT LERGDFLSEEWRERIANTS SVI

FVNNFAFGPEVDHQLKERFANMKEG - UNI1015 - GGRIVSSKPFAPLNFRINSRNLSD - UNI1015 - DIGTIMRVVELSPLKGSVSWTGKPV

SYYLHTIDRTI LENYFSSLKNPKLR - UNI603 - EEQEAARRRQQRENKSNATTPTKVPESKAAATEAPA DSGAEEEKSGVATVKKPSPSKARKK

KLNKKGRKMAGRKRGRPKKMSAASAERKSKKSQSTLDLLHSPPPAPPSASPQD - UNI12424 - DAYRAPHSPFYQLPPSTQLHSPNPLLVAPTPPA

LQKLLE - UNI12424 - ESFRIQYLQFLAYTKTPQYKANLQQLLDQEK EKNTQLLGTAQQLFGHCQAQKEEIRRLFQQKLDE LGVKALTYNDLIQ

AQKEISAHNQQLREQSEQLEKDNSELRSQSLRL LRARCEELRLDWSTLSLENLRKEKQALRSQISEKQRHCLELQ ISIVELEKTQRQQELLQLKSCVP

PDDALSLHLRGKGALGRELEADAGRLRLELDCAKISLPHLSSMSPELSMNGHAASYELCNAASRPSSKQNTPQYLASPLDQEVVPCTPSHSGRPRLEKLS

GLALPDYTRLSPAKIVLRRHLSQDHTGASKAATSEPHPR RPEHPKESSLPYQSPGLSNSMKLSPQDPPLASPATSPLTSEKGSEK GVKERAYSSHGET

ITSLPVSIPLSTVQPNKLPVSIPLASVVLPSRAERA RSTPSPVPQPRDSSATLEKQTGASAHGAGGAGAGSRSLAVAPTG GFYAGSVAISGALASSPA

PLASGMESAVFDESSGPSSLFATMGSRSTPPQHPPLLSQSRNSGPASPAHQLTASPRLSVTTQGSLPDTSKGELPSDPAFSDPESEAKRRIVFSISVGAS

SKQSPSTRHSPLTSGTRGDCVQSHGQDSRKRSRRKRASAGTPSLSTGVSPKRRALPTVAGLFTQSSGSPLNLNSM VSNINQPLEITAISSPESSLKSSP

TPYQDHDQPPVLRKERPLGLTNGAHYSPLTSDEEPGSEDEPSSAR RIERKIATISLESKSPPKTLENG GGGLVGRKSAPSSEPINSSKWKSTFSPISD

LGLAKAVDSPLQAGSALSHSPLFSFRPSLEEPAAEAKLPTHPRKSFAGSLGAAEGPSPGTNPPNGLAFSGGLAADLGLHSFNDGASLSHKGPDVTGLSAS

LSFPSQRGKDSTTEANPFLSRRQPEGLGGLKGEGNANKESGESLPLCGPSDKASLPHGSRASKGRDRELDFKGGHNLFISAAAVPPGGLLGGPGLVTVAS

SAGSATPTAQAPRPFLSTFAPGPQFTLGPMSLQANLGSVAGSSVLQSLFSTVPAAAGLVHVSSTATRLTNSHTMGSFSSGVAGGTVGG - UNI2414 -

 - UNI6411 - - UNI17986 - GN

For any suggestions or comments, please send an email to unitrap@crg.es