Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000061603 (Akap6)
Chromosomal location
Chr 12: 53800370 - 54252002 (+)
Description
A kinase (PRKA) anchor protein 6 Gene [Source:MGI Symbol;Acc:MGI:3050566]
RefSeq_dna
NM_198111 
RefSeq_peptide
NP_932779.2 
UniGene
Mm.310822 Mm.412720 
MGI
MGI:3050566 
Uniprot/SPTREMBL
Q3TRB0 Q3UHI8 Q3UHR2 Q6ZQD9 Q2VEB3 Q2VEB4 Q6PGB9 
Human Ortholog
ENSG00000151320 (AKAP6)
Omim not available
UniTrap UNI32251
Vector Insertion
Chr 12: 53800430 - 53896823
Public Clones (sanger) IST13650E8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI29899
Vector Insertion
Chr 12: 53981878 - 53987295
Public Clones E028F10 (ggtc)
Private Clones not available
Severity of mutation (?) Insertion after 8% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000095737
Sequence
AGTATTGCATCCTACAGATGTGCTGTAAACATCAAAAGGCGACGTTGGGAGCAGGAGATG - UNI32251 - CTGTTTTGGAAAGAAGTAAGGCTTAG

ATTTCTCCATGTTAACCATGAGTGTGACCCTTTCCCCACTGCGGTCCCAGGACCCAGACCCCATGGCGACTGATGCCTCGCCCATGGCCATCAACATGAC

ACCTACCGTGGAGCAGGAGGAAGGAGAGGGAGAAGAGGCCGTGAAGGACGTGGGTGCTGAGCAGCAGTATGGAAAGCCACCTCCACTCCACACAGCAGCC

GACTGGAAGATTGTCCTGCACTTACCTGAGATTGAGACCTGGCTCCGGATGACCTCAGAGAGGGTCCGTGACCTAACCTACTCGGTCCAGCAGGATGCAG

ACAGCAAGCATGTGGATGTGCATCTAGTTCAGCTAAAG GATATTTGCGAGGATATTTCCGACCACGTGGAGCAGATCCATGCCCTCCTTGAGACGGAGT

TCTCCCTGAAGCTGCTGTCCTACTCGGTCAATGTCATCGTAGACATCCACGCAGTGCAGCTGCTCTGGCACCAGCTCCGCGTATCCGTGCTGGTCCTCCG

GGAGCGCATCCTACAAGGTCTGCAGGACGCCAATGGCAACTACACCAGGCAGACTGACATTCTGCAAGCATTCTCTGAAGAAACAACAGAG - UNI298

99 - GGCCGGCTTGACTCCCTCACAGAAGTGGACGACTCTGGGCAGTTAACTATCAAATGCTCTCAGAATTATTTGTCTCTGGATTGTGGTATTACTGC

CTTTGAACTTTCTGACTACAGTCCAAGTGAGGATCTGCTTGGTGGCCTGGGCGACATGACCACTAGCCAGGCCAAAACTAAATCGTTTGACTCTTGGAGT

TACAGCGAGATGGAAAAGGAATTTCCCGAGCTCATCCGAAGCGTTGGGCTGCTTACAGTGGCCACTGAGCCTGTCCCTTCCAGCTGTGGAGCAGCCAATG

AGGACTCATCTCAAGTGATCCTTTCAGAGGACCACAGAGGTGGACATGAGGAAGATGGCGCTCTTGAACCTGGAGAGCAGCTGGGCTCAACACTGGAGAC

GTCTTCCTTAGGGGACACACTGACAAACGCTGCTGAACACCCTCCGGAGACAGCAAACCAAGACTCTACTTCCTCTCCGCAGCTTGGTGCGAAAAAATCC

CAGCCTGGTCCTTGTGAAATGATGACTCCCAAGAGATCCATCCGCGATTGCTTTAATTATAACGAGGACTCTCCCACGCAGCCCACATTGCCCAAAAGAG

GGCTATTTCTAAAAGAAACTCTTAAGAACGAGCGGAGAGGCAGTGATGGGAAGGGGAGGGTGGTTGACCTGAAGCCTGAGCTGAGCAGAAGCACCCCGTC

CCTGGTGGAACCCCCTGACAGATCGAAGCTCTGCCTAGTGTTGCAGTCTTCCTACCCCAGCAGCCCTTCTGCCGCCAGCCAGTCCTATGAGTGTTTGCAC

AAGGTGGGGATCGGCAATCTTGAAAACATAGTCAGAAGTCACATTAAAGAAATTTCTTCCAGTTTGGGAAGGCTTACTGACTGCCATAAAGAGAAACCGC

GACTGAAAAAGCCTCACAAGACCTTGGCCGAGGTGTCCCTGTGCAAAATACCTAAACGGGGAACTGGTTCAGGAAAGCAATCCGAGAATACCAGGAGCTC

AGTCGTGCCGACCATGGTGTCTCCTGGAGCTCCGAAAGCCACGGCGAGACCAGCAACAGATTCTGCGTCTACAACCTCAGGTGACACGTGCCATCAGAGA

AATCGGGGTGGAAAATTGCCAGCGCAGTCGAAGGCCTCCAGCTCATCCCCTTGTAGTCACAGCAGTGAGTCCTCTCTTGGCTCAGACAACATCAAATCCC

CACTTCCTCTCCTTTCAAAAAGCCAAAAAGGCTCCCCACCCGCTCCATGTCACGCCACACAGAACGGTCAGGTGGTGGAGGCCTGGTACGGCTCTGATGA

ATACCTAGCGCTGCCATCTCACCTCAAACAAACGGAGGTGTTAGCTCTGAAACTGGAGAACCTAACCAAGCTTCTACCCCAGAAACCCAGAGGAGAGACT

ATCCAGGATATTGATGACTGGGAACTGTCTGAGATGAATTCAGACTCTGAAATCTATCCAACGTACCATATCAAGAAAAAACACACAAGGCTAGGCACCG

TCTCTCCGAGCTCATCCAGCGACATAGCCTCATCTCTCGGGGAGAGCATTGAATCTGGGCCCCTGAGTGACATTCTTTCTGATGAGGACTTATGTATGCC

CCTCTCCGGCATGAAAAAGTTCACTGATGAGAAATCAGAGAGACCTTCATCCTCTGAGAAGAATGAGAGCCATTCTGCTACAAAATCAGCCTTAATTCAG

AAACTAATGAAAGATATTCAGCACCAAGATAACTATGAAGCCATCTGGGAAAGAATTGAG GGGTTTGTGAACAAGCTGGACGAATTCATTCAGTGGCTA

AACGAAGCCATGGAGACCACGGAGAACTGGACTCCGCCTAAAGCCGAGACCGACAGCCTCCGGCTGTACCTGGAGACACACTTG AGCTTTAAGTTGAAC

GTAGACAGTCACTGTGCCCTCAAGGAAGCCGTGGAGGAAGAAGGACACCAACTTCTTGAGCTCATTGCGTCTCACAAAGCAG GACTGAAGGACATGCTG

AAGATGATTGCAAGTCAATGGAAGGAGCTGCAGAGGCAAATCAAACGGCAACACAGCTGGATTCTCAGAGCCCTGGACACCATCAAAGCCGAGATACTGG

CTACTGATGTGTCTGTGGAGGACGAGGAGGGGACGGGGAGCCCCAAG GCTGAGGCTCAGCTCTGCTACCTGGAAGCTCAGAGAGACGCTGTGGAGCAGA

TGTCCCTCAAGCTGTACAGCGAGCAGTATACCAGTGGTAGCAAGAGGAAAGAAGAGTTTGCCGACATGTCGAAAGCGCATTCGGTGGGAAGCAATGG GC

TTCTGGACTTTGATTCAGAATATCAGGAGCTCTGGGATTGGCTGATTGACATGGAGTCCCTTGTGATGGACAGCCACGACCTGATGATGTCAGAGGAGCA

GCAGCAGCATCTTTACAAG CGCTACAGCGTGGAAATGTCCATCAGGCACCTGAAAAAGACAGAGCTACTTAGCAAGGTTGAAGCTTTGAAGAAAGGTGG

CCTTTCACTACCAAATGATATCCTGGAAAAAGTGGATTCAATTAATGAAAAATGGGAGCTGCTTGGG AAAACCCTAAGAGAGAAGATACAGGACACAAT

GGCAGGCCACAGTGGGTCGGGCCCACGTGACCTGCTCTCTCCTGAAAGCGGAAGCCTGGTAAGGCAGCTGGAGGTCAGGATCAAAGAGCTGAAAAGGTGG

CTAAGAGATACAGAGCTTTTCATCTTCAATTCCTGTCTGAGACAAGAGAAGGAAGGAACGAGCGCCGAGAAACAACTCCAATACTTTAAG TCGCTCTGT

CATGAGATCAAGCAGCGGCGTAGAGGAGTGGCCTCCATTCTGAGGTTGTGCCAGCACCTTCTGGATGACCGGGACACTTGTAATCTGAACGCAGATCACC

AGCCCATGCAGCTGATCATTGTAAACCTTGAAAGAAGGTGGGAAGCCATCGTCATGCAAGCTGTCCAGTGGCAAACACGGTTACGAAAGAAGATGGGAAA

AGAATCT GAGACTCTGAATGTGATTGACCCTGGCTTGATGGACCTGAATGGAATGAGTGAGGATGCCCTGGAATGGGATGAGACAGACATAAGTAACAA

ACTCATTAGTGTGCATGAAGAATCCAACGACCTTGATCAAGACCTGGAGCCTATGGTCCCAACAGTGAAACTTGAAGAGACACACCACAAGGACTCCGGT

TATGAAGAGGAGGCAGGTGACTGTGGAGGGTCCCAGTATACCTCAAATATCACTGCCCCTTCCAGCCCACACATTTACCAAGTGTACAGTCTCCACAATG

TTGAGTTCCACGAGGACAGCCACACTCAGTTTCTAAAAAGCAGCCCCAAGTTCACAGGCACAGTGCAGCCCACTGTTTTAACTAAGAGCCTCAGTAAAGA

TTCTTCATTTTCATCCACAAAATCGTTACCAGACCTTTTAGGGGGTTCCAGCTTGGTGAGGCCTTACTCGTGTCAGAGTGGAGACTTGAGCCAGAATTCA

GGCAGTGAGAGTGGAATTGTCAGCGAAGGAGACAATGAGATGCCAACCAACTCCGACATGAGCTTGTTCAGTATGGTCGATGGGTCCCCGAGTAACCCTG

AAACACAACATCTGGACCCACAAATGGGAGACGCAGCCAATGTGCTGGAGCAAAAATTTAAAGATGAGGGGGAGTGCATTAAGCTTTCAAGTGTCTCTCA

GGCATCTGTCTCACCAGTGGGTTGTGTAAATGGGAAAGCTGGGGACTTAAACAGTATTACCAAACACACCACTGATTGTTTGGGAGACGAATTACAAGGA

AAACATGAGGTGTTTACATTTTATGACTACTCGTACCTCCAAGGCTCAAAACTCAAATTCCCAATGATAATGAAACAGCCGCAGAGTGAGAAGGCACATT

TGGAGGATCCCCTTCTTCGTGGTTTCTATTTTGATAAAAAGTCCTGCAAACCTAAACATCAGACTTCTGAGTCACAACCAGACGCGCCCCTCCATGAAAA

GATCTTGGCAAGTGCCCCCCACGAGATGGGTCGAAGCTCATACAAAAGTAGCGACATAGAGAAGGCACTCACGGGCATCCAGAATGCCCGACAGCTCTCC

CTTTTATCTCGTAGCTCATCTGTAGAGTCCCTTTCCCCAGGGGGTGATTTGTTTGGATTGGGAATCTTTAAAAATGGCAGTGACAGCCTCCAGCGAAGCA

CTTCTTTAGAAAGTTGGTTGACATCCTATAAGAGCAACGAGGATCTTTTTAGCTGTCACAGCTCTGGGGACATAAGTGTGAGCAGTGGCTCGGTTGGTGA

GCTGAGCAAGAGGACATTAGATCTTTTGAATCGTCTGGAGAACATACAGAGCCCCTCAGAGCAAAAGATCAAGCGGAGTGTTTCAGATATCACTCTGCAA

AGCAGTTCCCAAAAGATGTCCTTCAGTGGCCAGATGTCACTGGATGTCGCATCCTCTATCAATGAAGACTCGCCGGCATCTCTTACCGAACTGAGTAGCA

GCGATGAGCTCTCTCTTTGCTCGGAGGACATTGTGTTACACAAAAACAAGGTCCCAGAGTCCAACGCATCATTCAGGAAGCGCCTGAATCGCTCGGTGGC

TGATGAGAGCGACGTCAATGTCAGCATGATTGTCAACGTCTCCTGCACCTCTGCTTGCACTGATGACGAAGACGACAGCGACCTCCTCTCCAGCTCCACT

CTCACCTTGACGGAAGAAGAGCTGTGTCTCAAAGATGAGGATGACGACTCCAGTATCGCAACGGATGATGAAATTTATGAGGAAAGCAACCTGATGTCTG

GGCTGGACTACATCAAGAACGAACTGCAGACGTGGATAAGACCCAAACTTTCCTTGTCGAGAGAAAAGAAACGGCCCAGTGTCACTGATGAAATAAAGGT

CAATAAAGATGGAGGAAGTACCGAGAGGGCCAATCCCTCGGACACCCTGGACATTGAGGCCCTTCTAAATTGCTCCATAAAACGTCTCTCTGAAAACAAT

GGGAATGGCAAGAACCCACCCAGAACTCATGACTTAGGAACCAAAGGTGAAAATAAGAAAAATACGTACGACGTTACTAAAGATCCACATGTGGCCGACA

TGGAAAATGGCAATGTTGAAAGTACTCCAGAGAGAGAAAAGGAGAAGCCAGAGATCCCAGAGGCATCAGCGAACCTTGCTTCAAATGTGAAAAAGATTTC

TGAATCCAAGCACGACGAGTATGAAGCATTAATGGATGGTTCTGATGATTCAAGTGTCACTGGGAAGGAATTTGGTCCCCCAAATGATAGGCATCCTCCA

CAGATTGGTGCCGATCCCCAGCATCCTGAAAGGGGTGACTGCACATCAGTCCAGAACTCTTGCTCAGGACTACTGTTGGAAACCGGTGGCGGAAGCAGAC

AAGATAGTGATGGACTCAAATCTTTGTCTAATGATGCACCAAGTGTGGCTAGAAACGCTGCTGGTTGCTGCCTACTCGAACAAAATGAGACAGAGGAAAG

TGCTTCTATCAGCAGCAGCACTTCCTGTTGCAACTGCAAGCCAGATGTTTTCCATCAGAAAGATGATGAAGATTGTTCGGTACATGACTTTGTTAAGGAA

ATCATTGACATGGCATCAACAGCCCTCAAAAGTAAATCACAACCTGAGAGTGAGGTGGCCGCTCCCACGTCACTGACCCAAATTAAGGAGAAAGTGTTAG

AGCATTCGCATCGGCCCATACACCTGAGGAAGGGAGATTTTTACTCCTACCTATCTCTTTCGTCCCATGACAGTGACTGTGGGGAGGTCACCAATTACAT

AGATGAGAAGAGCAACACCCCATTGCCACCAGACACCGTGGACTCTGGCTTAGATGACAAGGAAGACGTGGACTGCTTCTTTGAAGCTTGTGTTGAGGAC

GAGCCTGCTGATGAGGAAGCCCGTCTCTCCAGTGCCCTTCCAAATGAATCAGAAGTCCAGGATGAAGCTGCTAAGCCAGAACAAATGACAGCCAGCTCTT

CTGTGTTCCGTGATGAGACAGACACGGTGCCTCTTTCAGGACTTTCCCCTCAGAAGGGAGCTGATGATGCAAAGGAAGGAGATGGTGCGTCCCACACTTC

CCAGGGCTGTGTGGAGAGCGCAGAGCCTACCACCCCCCCAGGAAAGGCCAAGAGAGAGGGGAGTTCAAGAAAGCAAAGTGTATCAGGAACGCCAGAAGAA

AACGCTGCTTCAGCCAAACCGAAAATTCAAGCTTTCTCTTTGAATGCAAAACAGCCAAAAGGCAAGGCTGCACTGTATCCCAGCCCCCAAACTTTAACCT

GCAAAGAGAAGCTCGTAAGCTTTCATGAAGATCGACATAGTAACATGCATAGGTAGAATGTAATGCCCCCAAGCATGGAACTCATCTCATTGAAAG ATA

GCCTGGCTGAAGCTCGGGGCTGGCCTGACCCACCCTGGGCTGGTCTTGGGTTCCATCCTGTTATCATCACTGCCTCCTGCCACGTTGACTTCCTGAAGAC

GAACCTTCCTTCTGAATGCGGTCTGTCCACGTGGGCCTCCCGATATGGATGTGTGCATTGCTCCTCTTAGGTGATCGTCTTAGTTCCTCAAAGCTGCTTG

TTCTCCCGTGGATTCCTGTCCCAAGCTACCTCTGGCAACCCTCTCTCCAGCAAGACTTCTATTTTCCCTCTCTCCTCCCTCCTCCTTTTAAAGCTCTGCA

GTTCACCAAATTGATGGTCCATTAAACCCACTGTCTGGAATGACACCCCTCCCATCGGTACTTGACCAATTTTATGTTTTGCTCTGAAATTTTTCATGAT

ATTATGCCTATGTTTATTGAAAGAGATTTACCTAAAAAGCCATCCCTTGATTTGATTGTAGTATAGAAGAGACACATTGATCCTTATGACAAAATTAAGT

GATGTTTTGAAAGTGCCATTTTAATTATTTCTTTTTAATAATAATCTATGCAGCACTTCAAGAAACAACTATAACAGTGTTGTATAAACTGGTACATTCT

ACTATTAAGTTTGTTTTTGGTTTCTATGCTTCTTGAGGTGGTAATGAGAAAAATGTTTGTTTTTTTTTTTAAACGGTGTGCCTTGCTGTATTTCTTATAC

CATTTATTAAAAAGCTGCTTTTGTGGTAATATTATGTTGGTTTGAAAGGAGGAAATAGCAAGGTTAAGATGCGTGAATAATTTCTGTATATATGTATAAG

CTAATACAAACACTGATGTATGACAGTATAAAATGCTTTCATGTTTGTGATGTCCAGTGATGTGGAGAATATAAGCCTTAAACCCGTTCGATTGCATGGT

AATTAAAATTGGCATAATAAAAATAGCTTATTGGGGGAAAGGAAAATTAATGATCTCTTCTACCTGTGTTCTTTACCAAATTCTTGCATCTGGTTCTAGA

AAAGAAAAAAGAATCAAACTCCATATATTAGCTTCCAAAATATCCATATTGCACAGAAGGCTTACATTGCTTAGACTACAGACTAGGCCTGAAGCCTTCA

TAATTTTCAAAAATCTTTCTGTTTCACTATAAACATCCTGAAATAGCAAAGGTTTAAAGGCCATTTCCATCAACAATGTTTTATTCTAAATGTTTTTATT

TCTACTTGCTAATGGTTTAATAATAGTTGTATTTGGAGATCTCTTACATGACCTAATTTATTTTAAATATTTGAATGGTTTTGGTGGATGGTATAGAAAA

TTTGATTATTATTTTATTTAAACTATAGATTTCAGGTATATTTATTTTGTTAAGAAAAATCAACAGAGGAATATTCCATTTGGTCTTTTTTTTTTTTTGA

CTTGAAGAATTCAGCTTTTAATTTATATCATAACTCCTACTAAAGTGCCTGACACACAGTAGGTATTTCATAGAGTTTCCTGAATTTGAGTATTGAGTGG

GGTTTTACATATATATATTTATATATGTTTCCTGCATTAAAACTAGAAAAAGACGTGCAAAGTGAAGCACATCTATAATCACACATTTATAATCAGATTT

CCAAAAGCCAATAGAACATGACAGACATATGTAGCCACCGAAATGACAATCATTCATTCAATAGATTACTCATTAGCATCTTTTGCCTGCAAGTCACTAT

TCTATATTCAGGGAGAGCAGCTATGAACGATGCACTGCCTTTGGAGGTTTATCTATGTTTGAGACAGAGTGACTGACCACACAGACGTGTGTGCCATAAC

GTCCCACAGATGAGGAAGAAAGCAAGTGTAGAGAAAGAGTCACAACGAGAGAGACAGCGGTGAGAGGCTGGGGCAAAGAGAAAGGCTATGGGAGAAGAGG

GGTTAGCAGGGCTTCACTACATGTGTGAAAAGAGAGAAAGCCAAATAGAGAGACCTGCAAGATGTTTACAGAGCTGACATGGAGCGTTTGTGTGCTGTGT

AGTAGGTATAGGAGACCCAGTAGCTTGTGCGGGGCTTTATTTTATCCCACAATTGGAACTTTACTGGCGTCCTCCCAGGAACACTTAAATAATTTTGCGT

GGATTTTGCCCCTTCTAATCTTTGCTGCACATATTTTTAAATGGATGGCTCATTCTAGGCTTTTGGGTATGTAGTGACTTCTTCCAACGGAGTCTTAGAG

AGACATCTAGTTATAGTGTTTATGAGGATCACAAAGGGGAGATGTTAGACATAACTATGTTGTAGGGGGAAAGAAAGGGGAAATTAGCTAGATTTAAGGC

AATGACAGAGTGCACAGGGATCGTAGCCTGAAATACAGAGAAAGACAGATCTTAGAGCCCTGAAAAGTATTTGAACATTTTTGGACCTCTGTTAGGATAT

GGCATTATTTTATATACTGAGACAACCTGAATTTCTCTTAGTAAGTAATGTCAAGTCTAAGTCTATTGAAAAGACATTCAAAAAATTAATGGACCATGCT

GGACTATTTGCCTCTTTTGTACTCATGAAGACTTAGAATTTGAAAATATTTATTAGTTATCTGCTTAACACTAACACCAAGTTGATCAGGTTGACTCTTG

AGTTTATTGATGCCTTTTCCAGCCAGAAGAGATGGAAGAGCCTCAGTCTCATACCCTGTGTAGACACTAACTTCCCATCTGCATTTGAAAACAGCTCATT

TGGTTTGTATTGATTTGATCAACACTATCTACGCATGTCCCATGACAATTGTTTGTTATTTGTTAAGGCAAAGTATCCCTCTTATGGGCATGTGTTTCTG

TTAGAATGTGCTCTCTTAGGTTGCTAAATAAAGTCCACAGGGTACCCCTCCCCTTTTAGTTTGGTGTATTGGTCCTATGCCTGTGCTGCAGAGAGGCCCT

TAGAAGATTCCTGGTCCCTCTGTCTCATGGCCGCCCTTCAGGTAATTGAGAACAGTTACTCTCTTTCACAGGCAGTTCCTCCAACTGCCCTTCATATATC

ATGACTTCAGATCCATTTCAACCTGACTGAATGTTAAACAGGCAGAACCCTTGATGTCAAGGGACTGTCTTCATCCTACATGTAGAGAGGTGTGTGGACA

CTTAAGTGATAAGTTTTCTCAAAAATATATTCAAGATATATGTTTATTCTACTATTGTAAATTTCAATAAATAAACAAATAAACAAGTGAATAAAATAAG

AA
Translation
 - UNI32251 - MLTMSVTLSPLRSQDPDPMATDASPMAINMTPTVEQEEGEGEEAVKDVGAEQQYGKPPPLHTAADWKIVLHLPEIETWLRMTSERV

RDLTYSVQQDADSKHVDVHLVQLK DICEDISDHVEQIHALLETEFSLKLLSYSVNVIVDIHAVQLLWHQLRVSVLVLRERILQGLQDANGNYTRQTDIL

QAFSEETTE - UNI29899 - GRLDSLTEVDDSGQLTIKCSQNYLSLDCGITAFELSDYSPSEDLLGGLGDMTTSQAKTKSFDSWSYSEMEKEFPELI

RSVGLLTVATEPVPSSCGAANEDSSQVILSEDHRGGHEEDGALEPGEQLGSTLETSSLGDTLTNAAEHPPETANQDSTSSPQLGAKKSQPGPCEMMTPKR

SIRDCFNYNEDSPTQPTLPKRGLFLKETLKNERRGSDGKGRVVDLKPELSRSTPSLVEPPDRSKLCLVLQSSYPSSPSAASQSYECLHKVGIGNLENIVR

SHIKEISSSLGRLTDCHKEKPRLKKPHKTLAEVSLCKIPKRGTGSGKQSENTRSSVVPTMVSPGAPKATARPATDSASTTSGDTCHQRNRGGKLPAQSKA

SSSSPCSHSSESSLGSDNIKSPLPLLSKSQKGSPPAPCHATQNGQVVEAWYGSDEYLALPSHLKQTEVLALKLENLTKLLPQKPRGETIQDIDDWELSEM

NSDSEIYPTYHIKKKHTRLGTVSPSSSSDIASSLGESIESGPLSDILSDEDLCMPLSGMKKFTDEKSERPSSSEKNESHSATKSALIQKLMKDIQHQDNY

EAIWERIE GFVNKLDEFIQWLNEAMETTENWTPPKAETDSLRLYLETHL SFKLNVDSHCALKEAVEEEGHQLLELIASHKAG GLKDMLKMIASQWKE

LQRQIKRQHSWILRALDTIKAEILATDVSVEDEEGTGSPK AEAQLCYLEAQRDAVEQMSLKLYSEQYTSGSKRKEEFADMSKAHSVGSNG GLLDFDSE

YQELWDWLIDMESLVMDSHDLMMSEEQQQHLYK RYSVEMSIRHLKKTELLSKVEALKKGGLSLPNDILEKVDSINEKWELLG KTLREKIQDTMAGHSG

SGPRDLLSPESGSLVRQLEVRIKELKRWLRDTELFIFNSCLRQEKEGTSAEKQLQYFK SLCHEIKQRRRGVASILRLCQHLLDDRDTCNLNADHQPMQL

IIVNLERRWEAIVMQAVQWQTRLRKKMGKES ETLNVIDPGLMDLNGMSEDALEWDETDISNKLISVHEESNDLDQDLEPMVPTVKLEETHHKDSGYEEE

AGDCGGSQYTSNITAPSSPHIYQVYSLHNVEFHEDSHTQFLKSSPKFTGTVQPTVLTKSLSKDSSFSSTKSLPDLLGGSSLVRPYSCQSGDLSQNSGSES

GIVSEGDNEMPTNSDMSLFSMVDGSPSNPETQHLDPQMGDAANVLEQKFKDEGECIKLSSVSQASVSPVGCVNGKAGDLNSITKHTTDCLGDELQGKHEV

FTFYDYSYLQGSKLKFPMIMKQPQSEKAHLEDPLLRGFYFDKKSCKPKHQTSESQPDAPLHEKILASAPHEMGRSSYKSSDIEKALTGIQNARQLSLLSR

SSSVESLSPGGDLFGLGIFKNGSDSLQRSTSLESWLTSYKSNEDLFSCHSSGDISVSSGSVGELSKRTLDLLNRLENIQSPSEQKIKRSVSDITLQSSSQ

KMSFSGQMSLDVASSINEDSPASLTELSSSDELSLCSEDIVLHKNKVPESNASFRKRLNRSVADESDVNVSMIVNVSCTSACTDDEDDSDLLSSSTLTLT

EEELCLKDEDDDSSIATDDEIYEESNLMSGLDYIKNELQTWIRPKLSLSREKKRPSVTDEIKVNKDGGSTERANPSDTLDIEALLNCSIKRLSENNGNGK

NPPRTHDLGTKGENKKNTYDVTKDPHVADMENGNVESTPEREKEKPEIPEASANLASNVKKISESKHDEYEALMDGSDDSSVTGKEFGPPNDRHPPQIGA

DPQHPERGDCTSVQNSCSGLLLETGGGSRQDSDGLKSLSNDAPSVARNAAGCCLLEQNETEESASISSSTSCCNCKPDVFHQKDDEDCSVHDFVKEIIDM

ASTALKSKSQPESEVAAPTSLTQIKEKVLEHSHRPIHLRKGDFYSYLSLSSHDSDCGEVTNYIDEKSNTPLPPDTVDSGLDDKEDVDCFFEACVEDEPAD

EEARLSSALPNESEVQDEAAKPEQMTASSSVFRDETDTVPLSGLSPQKGADDAKEGDGASHTSQGCVESAEPTTPPGKAKREGSSRKQSVSGTPEENAAS

AKPKIQAFSLNAKQPKGKAALYPSPQTLTCKEKLVSFHEDRHSNMHR 
Transcript ENSMUST00000110722
Sequence
AGTATTGCATCCTACAGATGTGCTGTAAACATCAAAAGGCGACGTTGGGAGCAGGAGATG - UNI32251 - CTGTTTTGGAAAGAAGTAAGGCTTAG

ATTTCTCCATGTTAACCATGAGTGTGACCCTTTCCCCACTGCGGTCCCAGGACCCAGACCCCATGGCGACTGATGCCTCGCCCATGGCCATCAACATGAC

ACCTACCGTGGAGCAGGAGGAAGGAGAGGGAGAAGAGGCCGTGAAGGACGTGGGTGCTGAGCAGCAGTATGGAAAGCCACCTCCACTCCACACAGCAGCC

GACTGGAAGATTGTCCTGCACTTACCTGAGATTGAGACCTGGCTCCGGATGACCTCAGAGAGGGTCCGTGACCTAACCTACTCGGTCCAGCAGGATGCAG

ACAGCAAGCATGTGGATGTGCATCTAGTTCAGCTAAAG GATATTTGCGAGGATATTTCCGACCACGTGGAGCAGATCCATGCCCTCCTTGAGACGGAGT

TCTCCCTGAAGCTGCTGTCCTACTCGGTCAATGTCATCGTAGACATCCACGCAGTGCAGCTGCTCTGGCACCAGCTCCGCGTATCCGTGCTGGTCCTCCG

GGAGCGCATCCTACAAGGTCTGCAGGACGCCAATGGCAACTACACCAGGCAGACTGACATTCTGCAAGCATTCTCTGAAGAAACAACAGAG - UNI298

99 - GGCCGGCTTGACTCCCTCACAGAAGTGGACGACTCTGGGCAGTTAACTATCAAATGCTCTCAGAATTATTTGTCTCTGGATTGTGGTATTACTGC

CTTTGAACTTTCTGACTACAGTCCAAGTGAGGATCTGCTTGGTGGCCTGGGCGACATGACCACTAGCCAGGCCAAAACTAAATCGTTTGACTCTTGGAGT

TACAGCGAGATGGAAAAGGAATTTCCCGAGCTCATCCGAAGCGTTGGGCTGCTTACAGTGGCCACTGAGCCTGTCCCTTCCAGCTGTGGAGCAGCCAATG

AGGACTCATCTCAAGTGATCCTTTCAGAGGACCACAGAGGTGGACATGAGGAAGATGGCGCTCTTGAACCTGGAGAGCAGCTGGGCTCAACACTGGAGAC

GTCTTCCTTAGGGGACACACTGACAAACGCTGCTGAACACCCTCCGGAGACAGCAAACCAAGACTCTACTTCCTCTCCGCAGCTTGGTGCGAAAAAATCC

CAGCCTGGTCCTTGTGAAATGATGACTCCCAAGAGATCCATCCGCGATTGCTTTAATTATAACGAGGACTCTCCCACGCAGCCCACATTGCCCAAAAGAG

GGCTATTTCTAAAAGAAACTCTTAAGAACGAGCGGAGAGGCAGTGATGGGAAGGGGAGGGTGGTTGACCTGAAGCCTGAGCTGAGCAGAAGCACCCCGTC

CCTGGTGGAACCCCCTGACAGATCGAAGCTCTGCCTAGTGTTGCAGTCTTCCTACCCCAGCAGCCCTTCTGCCGCCAGCCAGTCCTATGAGTGTTTGCAC

AAGGTGGGGATCGGCAATCTTGAAAACATAGTCAGAAGTCACATTAAAGAAATTTCTTCCAGTTTGGGAAGGCTTACTGACTGCCATAAAGAGAAACCGC

GACTGAAAAAGCCTCACAAGACCTTGGCCGAGGTGTCCCTGTGCAAAATACCTAAACGGGGAACTGGTTCAGGAAAGCAATCCGAGAATACCAGGAGCTC

AGTCGTGCCGACCATGGTGTCTCCTGGAGCTCCGAAAGCCACGGCGAGACCAGCAACAGATTCTGCGTCTACAACCTCAGGTGACACGTGCCATCAGAGA

AATCGGGGTGGAAAATTGCCAGCGCAGTCGAAGGCCTCCAGCTCATCCCCTTGTAGTCACAGCAGTGAGTCCTCTCTTGGCTCAGACAACATCAAATCCC

CACTTCCTCTCCTTTCAAAAAGCCAAAAAGGCTCCCCACCCGCTCCATGTCACGCCACACAGAACGGTCAGGTGGTGGAGGCCTGGTACGGCTCTGATGA

ATACCTAGCGCTGCCATCTCACCTCAAACAAACGGAGGTGTTAGCTCTGAAACTGGAGAACCTAACCAAGCTTCTACCCCAGAAACCCAGAGGAGAGACT

ATCCAGGATATTGATGACTGGGAACTGTCTGAGATGAATTCAGACTCTGAAATCTATCCAACGTACCATATCAAGAAAAAACACACAAGGCTAGGCACCG

TCTCTCCGAGCTCATCCAGCGACATAGCCTCATCTCTCGGGGAGAGCATTGAATCTGGGCCCCTGAGTGACATTCTTTCTGATGAGGACTTATGTATGCC

CCTCTCCGGCATGAAAAAGTTCACTGATGAGAAATCAGAGAGACCTTCATCCTCTGAGAAGAATGAGAGCCATTCTGCTACAAAATCAGCCTTAATTCAG

AAACTAATGAAAGATATTCAGCACCAAGATAACTATGAAGCCATCTGGGAAAGAATTGAG GTT GGGTTTGTGAACAAGCTGGACGAATTCATTCAGTG

GCTAAACGAAGCCATGGAGACCACGGAGAACTGGACTCCGCCTAAAGCCGAGACCGACAGCCTCCGGCTGTACCTGGAGACACACTTG AGCTTTAAGTT

GAACGTAGACAGTCACTGTGCCCTCAAGGAAGCCGTGGAGGAAGAAGGACACCAACTTCTTGAGCTCATTGCGTCTCACAAAGCAG GACTGAAGGACAT

GCTGAAGATGATTGCAAGTCAATGGAAGGAGCTGCAGAGGCAAATCAAACGGCAACACAGCTGGATTCTCAGAGCCCTGGACACCATCAAAGCCGAGATA

CTGGCTACTGATGTGTCTGTGGAGGACGAGGAGGGGACGGGGAGCCCCAAG GCTGAGGCTCAGCTCTGCTACCTGGAAGCTCAGAGAGACGCTGTGGAG

CAGATGTCCCTCAAGCTGTACAGCGAGCAGTATACCAGTGGTAGCAAGAGGAAAGAAGAGTTTGCCGACATGTCGAAAGCGCATTCGGTGGGAAGCAATG

G GCTTCTGGACTTTGATTCAGAATATCAGGAGCTCTGGGATTGGCTGATTGACATGGAGTCCCTTGTGATGGACAGCCACGACCTGATGATGTCAGAGG

AGCAGCAGCAGCATCTTTACAAG CGCTACAGCGTGGAAATGTCCATCAGGCACCTGAAAAAGACAGAGCTACTTAGCAAGGTTGAAGCTTTGAAGAAAG

GTGGCCTTTCACTACCAAATGATATCCTGGAAAAAGTGGATTCAATTAATGAAAAATGGGAGCTGCTTGGG AAAACCCTAAGAGAGAAGATACAGGACA

CAATGGCAGGCCACAGTGGGTCGGGCCCACGTGACCTGCTCTCTCCTGAAAGCGGAAGCCTGGTAAGGCAGCTGGAGGTCAGGATCAAAGAGCTGAAAAG

GTGGCTAAGAGATACAGAGCTTTTCATCTTCAATTCCTGTCTGAGACAAGAGAAGGAAGGAACGAGCGCCGAGAAACAACTCCAATACTTTAAG TCGCT

CTGTCATGAGATCAAGCAGCGGCGTAGAGGAGTGGCCTCCATTCTGAGGTTGTGCCAGCACCTTCTGGATGACCGGGACACTTGTAATCTGAACGCAGAT

CACCAGCCCATGCAGCTGATCATTGTAAACCTTGAAAGAAGGTGGGAAGCCATCGTCATGCAAGCTGTCCAGTGGCAAACACGGTTACGAAAGAAGATGG

GAAAAGAATCT GAGACTCTGAATGTGATTGACCCTGGCTTGATGGACCTGAATGGAATGAGTGAGGATGCCCTGGAATGGGATGAGACAGACATAAGTA

ACAAACTCATTAGTGTGCATGAAGAATCCAACGACCTTGATCAAGACCTGGAGCCTATGGTCCCAACAGTGAAACTTGAAGAGACACACCACAAGGACTC

CGGTTATGAAGAGGAGGCAGGTGACTGTGGAGGGTCCCAGTATACCTCAAATATCACTGCCCCTTCCAGCCCACACATTTACCAAGTGTACAGTCTCCAC

AATGTTGAGTTCCACGAGGACAGCCACACTCAGTTTCTAAAAAGCAGCCCCAAGTTCACAGGCACAGTGCAGCCCACTGTTTTAACTAAGAGCCTCAGTA

AAGATTCTTCATTTTCATCCACAAAATCGTTACCAGACCTTTTAGGGGGTTCCAGCTTGGTGAGGCCTTACTCGTGTCAGAGTGGAGACTTGAGCCAGAA

TTCAGGCAGTGAGAGTGGAATTGTCAGCGAAGGAGACAATGAGATGCCAACCAACTCCGACATGAGCTTGTTCAGTATGGTCGATGGGTCCCCGAGTAAC

CCTGAAACACAACATCTGGACCCACAAATGGGAGACGCAGCCAATGTGCTGGAGCAAAAATTTAAAGATGAGGGGGAGTGCATTAAGCTTTCAAGTGTCT

CTCAGGCATCTGTCTCACCAGTGGGTTGTGTAAATGGGAAAGCTGGGGACTTAAACAGTATTACCAAACACACCACTGATTGTTTGGGAGACGAATTACA

AGGAAAACATGAGGTGTTTACATTTTATGACTACTCGTACCTCCAAGGCTCAAAACTCAAATTCCCAATGATAATGAAACAGCCGCAGAGTGAGAAGGCA

CATTTGGAGGATCCCCTTCTTCGTGGTTTCTATTTTGATAAAAAGTCCTGCAAACCTAAACATCAGACTTCTGAGTCACAACCAGACGCGCCCCTCCATG

AAAAGATCTTGGCAAGTGCCCCCCACGAGATGGGTCGAAGCTCATACAAAAGTAGCGACATAGAGAAGGCACTCACGGGCATCCAGAATGCCCGACAGCT

CTCCCTTTTATCTCGTAGCTCATCTGTAGAGTCCCTTTCCCCAGGGGGTGATTTGTTTGGATTGGGAATCTTTAAAAATGGCAGTGACAGCCTCCAGCGA

AGCACTTCTTTAGAAAGTTGGTTGACATCCTATAAGAGCAACGAGGATCTTTTTAGCTGTCACAGCTCTGGGGACATAAGTGTGAGCAGTGGCTCGGTTG

GTGAGCTGAGCAAGAGGACATTAGATCTTTTGAATCGTCTGGAGAACATACAGAGCCCCTCAGAGCAAAAGATCAAGCGGAGTGTTTCAGATATCACTCT

GCAAAGCAGTTCCCAAAAGATGTCCTTCAGTGGCCAGATGTCACTGGATGTCGCATCCTCTATCAATGAAGACTCGCCGGCATCTCTTACCGAACTGAGT

AGCAGCGATGAGCTCTCTCTTTGCTCGGAGGACATTGTGTTACACAAAAACAAGGTCCCAGAGTCCAACGCATCATTCAGGAAGCGCCTGAATCGCTCGG

TGGCTGATGAGAGCGACGTCAATGTCAGCATGATTGTCAACGTCTCCTGCACCTCTGCTTGCACTGATGACGAAGACGACAGCGACCTCCTCTCCAGCTC

CACTCTCACCTTGACGGAAGAAGAGCTGTGTCTCAAAGATGAGGATGACGACTCCAGTATCGCAACGGATGATGAAATTTATGAGGAAAGCAACCTGATG

TCTGGGCTGGACTACATCAAGAACGAACTGCAGACGTGGATAAGACCCAAACTTTCCTTGTCGAGAGAAAAGAAACGGCCCAGTGTCACTGATGAAATAA

AGGTCAATAAAGATGGAGGAAGTACCGAGAGGGCCAATCCCTCGGACACCCTGGACATTGAGGCCCTTCTAAATTGCTCCATAAAACGTCTCTCTGAAAA

CAATGGGAATGGCAAGAACCCACCCAGAACTCATGACTTAGGAACCAAAGGTGAAAATAAGAAAAATACGTACGACGTTACTAAAGATCCACATGTGGCC

GACATGGAAAATGGCAATGTTGAAAGTACTCCAGAGAGAGAAAAGGAGAAGCCAGAGATCCCAGAGGCATCAGCGAACCTTGCTTCAAATGTGAAAAAGA

TTTCTGAATCCAAGCACGACGAGTATGAAGCATTAATGGATGGTTCTGATGATTCAAGTGTCACTGGGAAGGAATTTGGTCCCCCAAATGATAGGCATCC

TCCACAGATTGGTGCCGATCCCCAGCATCCTGAAAGGGGTGACTGCACATCAGTCCAGAACTCTTGCTCAGGACTACTGTTGGAAACCGGTGGCGGAAGC

AGACAAGATAGTGATGGACTCAAATCTTTGTCTAATGATGCACCAAGTGTGGCTAGAAACGCTGCTGGTTGCTGCCTACTCGAACAAAATGAGACAGAGG

AAAGTGCTTCTATCAGCAGCAGCACTTCCTGTTGCAACTGCAAGCCAGATGTTTTCCATCAGAAAGATGATGAAGATTGTTCGGTACATGACTTTGTTAA

GGAAATCATTGACATGGCATCAACAGCCCTCAAAAGTAAATCACAACCTGAGAGTGAGGTGGCCGCTCCCACGTCACTGACCCAAATTAAGGAGAAAGTG

TTAGAGCATTCGCATCGGCCCATACACCTGAGGAAGGGAGATTTTTACTCCTACCTATCTCTTTCGTCCCATGACAGTGACTGTGGGGAGGTCACCAATT

ACATAGATGAGAAGAGCAACACCCCATTGCCACCAGACACCGTGGACTCTGGCTTAGATGACAAGGAAGACGTGGACTGCTTCTTTGAAGCTTGTGTTGA

GGACGAGCCTGCTGATGAGGAAGCCCGTCTCTCCAGTGCCCTTCCAAATGAATCAGAAGTCCAGGATGAAGCTGCTAAGCCAGAACAAATGACAGCCAGC

TCTTCTGTGTTCCGTGATGAGACAGACACGGTGCCTCTTTCAGGACTTTCCCCTCAGAAGGGAGCTGATGATGCAAAGGAAGGAGATGGTGCGTCCCACA

CTTCCCAGGGCTGTGTGGAGAGCGCAGAGCCTACCACCCCCCCAGGAAAGGCCAAGAGAGAGGGGAGTTCAAGAAAGCAAAGTGTATCAGGAACGCCAGA

AGAAAACGCTGCTTCAGCCAAACCGAAAATTCAAGCTTTCTCTTTGAATGCAAAACAGCCAAAAGGCAAGGCTGCACTGTATCCCAGCCCCCAAACTTTA

ACCTGCAAAGAGAAGCTCGTAAGCTTTCATGAAGATCGACATAGTAACATGCATAGGTAGAATGTAATGCCCCCAAGCATGGAACTCATCTCATTGAAAG

 ATAGCCTGGCTGAAGCTCGGGGCTGGCCTGACCCACCCTGGGCTGGTCTTGGGTTCCATCCTGTTATCATCACTGCCTCCTGCCACGTTGACTTCCTGA

AGACGAACCTTCCTTCTGAATGCGGTCTGTCCACGTGGGCCTCCCGATATGGATGTGTGCATTGCTCCTCTTAGGTGATCGTCTTAGTTCCTCAAAGCTG

CTTGTTCTCCCGTGGATTCCTGTCCCAAGCTACCTCTGGCAACCCTCTCTCCAGCAAGACTTCTATTTTCCCTCTCTCCTCCCTCCTCCTTTTAAAGCTC

TGCAGTTCACCAAATTGATGGTCCATTAAACCCACTGTCTGGAATGACACCCCTCCCATCGGTACTTGACCAATTTTATGTTTTGCTCTGAAATTTTTCA

TGATATTATGCCTATGTTTATTGAAAGAGATTTACCTAAAAAGCCATCCCTTGATTTGATTGTAGTATAGAAGAGACACATTGATCCTTATGACAAAATT

AAGTGATGTTTTGAAAGTGCCATTTTAATTATTTCTTTTTAATAATAATCTATGCAGCACTTCAAGAAACAACTATAACAGTGTTGTATAAACTGGTACA

TTCTACTATTAAGTTTGTTTTTGGTTTCTATGCTTCTTGAGGTGGTAATGAGAAAAATGTTTGTTTTTTTTTTTAAACGGTGTGCCTTGCTGTATTTCTT

ATACCATTTATTAAAAAGCTGCTTTTGTGGTAATATTATGTTGGTTTGAAAGGAGGAAATAGCAAGGTTAAGATGCGTGAATAATTTCTGTATATATGTA

TAAGCTAATACAAACACTGATGTATGACAGTATAAAATGCTTTCATGTTTGTGATGTCCAGTGATGTGGAGAATATAAGCCTTAAACCCGTTCGATTGCA

TGGTAATTAAAATTGGCATAATAAAAATAGCTTATTGGGGGAAAGGAAAATTAATGATCTCTTCTACCTGTGTTCTTTACCAAATTCTTGCATCTGGTTC

TAGAAAAGAAAAAAGAATCAAACTCCATATATTAGCTTCCAAAATATCCATATTGCACAGAAGGCTTACATTGCTTAGACTACAGACTAGGCCTGAAGCC

TTCATAATTTTCAAAAATCTTTCTGTTTCACTATAAACATCCTGAAATAGCAAAGGTTTAAAGGCCATTTCCATCAACAATGTTTTATTCTAAATGTTTT

TATTTCTACTTGCTAATGGTTTAATAATAGTTGTATTTGGAGATCTCTTACATGACCTAATTTATTTTAAATATTTGAATGGTTTTGGTGGATGGTATAG

AAAATTTGATTATTATTTTATTTAAACTATAGATTTCAGGTATATTTATTTTGTTAAGAAAAATCAACAGAGGAATATTCCATTTGGTCTTTTTTTTTTT

TTGACTTGAAGAATTCAGCTTTTAATTTATATCATAACTCCTACTAAAGTGCCTGACACACAGTAGGTATTTCATAGAGTTTCCTGAATTTGAGTATTGA

GTGGGGTTTTACATATATATATTTATATATGTTTCCTGCATTAAAACTAGAAAAAGACGTGCAAAGTGAAGCACATCTATAATCACACATTTATAATCAG

ATTTCCAAAAGCCAATAGAACATGACAGACATATGTAGCCACCGAAATGACAATCATTCATTCAATAGATTACTCATTAGCATCTTTTGCCTGCAAGTCA

CTATTCTATATTCAGGGAGAGCAGCTATGAACGATGCACTGCCTTTGGAGGTTTATCTATGTTTGAGACAGAGTGACTGACCACACAGACGTGTGTGCCA

TAACGTCCCACAGATGAGGAAGAAAGCAAGTGTAGAGAAAGAGTCACAACGAGAGAGACAGCGGTGAGAGGCTGGGGCAAAGAGAAAGGCTATGGGAGAA

GAGGGGTTAGCAGGGCTTCACTACATGTGTGAAAAGAGAGAAAGCCAAATAGAGAGACCTGCAAGATGTTTACAGAGCTGACATGGAGCGTTTGTGTGCT

GTGTAGTAGGTATAGGAGACCCAGTAGCTTGTGCGGGGCTTTATTTTATCCCACAATTGGAACTTTACTGGCGTCCTCCCAGGAACACTTAAATAATTTT

GCGTGGATTTTGCCCCTTCTAATCTTTGCTGCACATATTTTTAAATGGATGGCTCATTCTAGGCTTTTGGGTATGTAGTGACTTCTTCCAACGGAGTCTT

AGAGAGACATCTAGTTATAGTGTTTATGAGGATCACAAAGGGGAGATGTTAGACATAACTATGTTGTAGGGGGAAAGAAAGGGGAAATTAGCTAGATTTA

AGGCAATGACAGAGTGCACAGGGATCGTAGCCTGAAATACAGAGAAAGACAGATCTTAGAGCCCTGAAAAGTATTTGAACATTTTTGGACCTCTGTTAGG

ATATGGCATTATTTTATATACTGAGACAACCTGAATTTCTCTTAGTAAGTAATGTCAAGTCTAAGTCTATTGAAAAGACATTCAAAAAATTAATGGACCA

TGCTGGACTATTTGCCTCTTTTGTACTCATGAAGACTTAGAATTTGAAAATATTTATTAGTTATCTGCTTAACACTAACACCAAGTTGATCAGGTTGACT

CTTGAGTTTATTGATGCCTTTTCCAGCCAGAAGAGATGGAAGAGCCTCAGTCTCATACCCTGTGTAGACACTAACTTCCCATCTGCATTTGAAAACAGCT

CATTTGGTTTGTATTGATTTGATCAACACTATCTACGCATGTCCCATGACAATTGTTTGTTATTTGTTAAGGCAAAGTATCCCTCTTATGGGCATGTGTT

TCTGTTAGAATGTGCTCTCTTAGGTTGCTAAATAAAGTCCACAGGGTACCCCTCCCCTTTTAGTTTGGTGTATTGGTCCTATGCCTGTGCTGCAGAGAGG

CCCTTAGAAGATTCCTGGTCCCTCTGTCTCATGGCCGCCCTTCAGGTAATTGAGAACAGTTACTCTCTTTCACAGGCAGTTCCTCCAACTGCCCTTCATA

TATCATGACTTCAGATCCATTTCAACCTGACTGAATGTTAAACAGGCAGAACCCTTGATGTCAAGGGACTGTCTTCATCCTACATGTAGAGAGGTGTGTG

GACACTTAAGTGATAAGTTTTCTCAAAAATATATTCAAGATATATGTTTATTCTACTATTGTAAATTTCAATAAATAAACAAATAAACAAGTGAATAAAA

TAAGAA
Translation
 - UNI32251 - MLTMSVTLSPLRSQDPDPMATDASPMAINMTPTVEQEEGEGEEAVKDVGAEQQYGKPPPLHTAADWKIVLHLPEIETWLRMTSERV

RDLTYSVQQDADSKHVDVHLVQLK DICEDISDHVEQIHALLETEFSLKLLSYSVNVIVDIHAVQLLWHQLRVSVLVLRERILQGLQDANGNYTRQTDIL

QAFSEETTE - UNI29899 - GRLDSLTEVDDSGQLTIKCSQNYLSLDCGITAFELSDYSPSEDLLGGLGDMTTSQAKTKSFDSWSYSEMEKEFPELI

RSVGLLTVATEPVPSSCGAANEDSSQVILSEDHRGGHEEDGALEPGEQLGSTLETSSLGDTLTNAAEHPPETANQDSTSSPQLGAKKSQPGPCEMMTPKR

SIRDCFNYNEDSPTQPTLPKRGLFLKETLKNERRGSDGKGRVVDLKPELSRSTPSLVEPPDRSKLCLVLQSSYPSSPSAASQSYECLHKVGIGNLENIVR

SHIKEISSSLGRLTDCHKEKPRLKKPHKTLAEVSLCKIPKRGTGSGKQSENTRSSVVPTMVSPGAPKATARPATDSASTTSGDTCHQRNRGGKLPAQSKA

SSSSPCSHSSESSLGSDNIKSPLPLLSKSQKGSPPAPCHATQNGQVVEAWYGSDEYLALPSHLKQTEVLALKLENLTKLLPQKPRGETIQDIDDWELSEM

NSDSEIYPTYHIKKKHTRLGTVSPSSSSDIASSLGESIESGPLSDILSDEDLCMPLSGMKKFTDEKSERPSSSEKNESHSATKSALIQKLMKDIQHQDNY

EAIWERIE V GFVNKLDEFIQWLNEAMETTENWTPPKAETDSLRLYLETHL SFKLNVDSHCALKEAVEEEGHQLLELIASHKAG GLKDMLKMIASQW

KELQRQIKRQHSWILRALDTIKAEILATDVSVEDEEGTGSPK AEAQLCYLEAQRDAVEQMSLKLYSEQYTSGSKRKEEFADMSKAHSVGSNG GLLDFD

SEYQELWDWLIDMESLVMDSHDLMMSEEQQQHLYK RYSVEMSIRHLKKTELLSKVEALKKGGLSLPNDILEKVDSINEKWELLG KTLREKIQDTMAGH

SGSGPRDLLSPESGSLVRQLEVRIKELKRWLRDTELFIFNSCLRQEKEGTSAEKQLQYFK SLCHEIKQRRRGVASILRLCQHLLDDRDTCNLNADHQPM

QLIIVNLERRWEAIVMQAVQWQTRLRKKMGKES ETLNVIDPGLMDLNGMSEDALEWDETDISNKLISVHEESNDLDQDLEPMVPTVKLEETHHKDSGYE

EEAGDCGGSQYTSNITAPSSPHIYQVYSLHNVEFHEDSHTQFLKSSPKFTGTVQPTVLTKSLSKDSSFSSTKSLPDLLGGSSLVRPYSCQSGDLSQNSGS

ESGIVSEGDNEMPTNSDMSLFSMVDGSPSNPETQHLDPQMGDAANVLEQKFKDEGECIKLSSVSQASVSPVGCVNGKAGDLNSITKHTTDCLGDELQGKH

EVFTFYDYSYLQGSKLKFPMIMKQPQSEKAHLEDPLLRGFYFDKKSCKPKHQTSESQPDAPLHEKILASAPHEMGRSSYKSSDIEKALTGIQNARQLSLL

SRSSSVESLSPGGDLFGLGIFKNGSDSLQRSTSLESWLTSYKSNEDLFSCHSSGDISVSSGSVGELSKRTLDLLNRLENIQSPSEQKIKRSVSDITLQSS

SQKMSFSGQMSLDVASSINEDSPASLTELSSSDELSLCSEDIVLHKNKVPESNASFRKRLNRSVADESDVNVSMIVNVSCTSACTDDEDDSDLLSSSTLT

LTEEELCLKDEDDDSSIATDDEIYEESNLMSGLDYIKNELQTWIRPKLSLSREKKRPSVTDEIKVNKDGGSTERANPSDTLDIEALLNCSIKRLSENNGN

GKNPPRTHDLGTKGENKKNTYDVTKDPHVADMENGNVESTPEREKEKPEIPEASANLASNVKKISESKHDEYEALMDGSDDSSVTGKEFGPPNDRHPPQI

GADPQHPERGDCTSVQNSCSGLLLETGGGSRQDSDGLKSLSNDAPSVARNAAGCCLLEQNETEESASISSSTSCCNCKPDVFHQKDDEDCSVHDFVKEII

DMASTALKSKSQPESEVAAPTSLTQIKEKVLEHSHRPIHLRKGDFYSYLSLSSHDSDCGEVTNYIDEKSNTPLPPDTVDSGLDDKEDVDCFFEACVEDEP

ADEEARLSSALPNESEVQDEAAKPEQMTASSSVFRDETDTVPLSGLSPQKGADDAKEGDGASHTSQGCVESAEPTTPPGKAKREGSSRKQSVSGTPEENA

ASAKPKIQAFSLNAKQPKGKAALYPSPQTLTCKEKLVSFHEDRHSNMHR 
Transcript ENSMUST00000065911
Sequence
AGTATTGCATCCTACAGATGTGCTGTAAACATCAAAAGGCGACGTTGGGAGCAGGAGATG - UNI32251 - CTGTTTTGGAAAGAAGTAAGGCTTAG

ATTTCTCCATGTTAACCATGAGTGTGACCCTTTCCCCACTGCGGTCCCAGGACCCAGACCCCATGGCGACTGATGCCTCGCCCATGGCCATCAACATGAC

ACCTACCGTGGAGCAGGAGGAAGGAGAGGGAGAAGAGGCCGTGAAGGACGTGGGTGCTGAGCAGCAGTATGGAAAGCCACCTCCACTCCACACAGCAGCC

GACTGGAAGATTGTCCTGCACTTACCTGAGATTGAGACCTGGCTCCGGATGACCTCAGAGAGGGTCCGTGACCTAACCTACTCGGTCCAGCAGGATGCAG

ACAGCAAGCATGTGGATGTGCATCTAGTTCAGCTAAAG GATATTTGCGAGGATATTTCCGACCACGTGGAGCAGATCCATGCCCTCCTTGAGACGGAGT

TCTCCCTGAAGCTGCTGTCCTACTCGGTCAATGTCATCGTAGACATCCACGCAGTGCAGCTGCTCTGGCACCAGCTCCGCGTATCCGTGCTGGTCCTCCG

GGAGCGCATCCTACAAGGTCTGCAGGACGCCAATGGCAACTACACCAGGCAGACTGACATTCTGCAAGCATTCTCTGAAGAAACAACAGAG - UNI298

99 - GGCCGGCTTGACTCCCTCACAGAAGTGGACGACTCTGGGCAGTTAACTATCAAATGCTCTCAGAATTATTTGTCTCTGGATTGTGGTATTACTGC

CTTTGAACTTTCTGACTACAGTCCAAGTGAGGATCTGCTTGGTGGCCTGGGCGACATGACCACTAGCCAGGCCAAAACTAAATCGTTTGACTCTTGGAGT

TACAGCGAGATGGAAAAGGAATTTCCCGAGCTCATCCGAAGCGTTGGGCTGCTTACAGTGGCCACTGAGCCTGTCCCTTCCAGCTGTGGAGCAGCCAATG

AGGACTCATCTCAAGTGATCCTTTCAGAGGACCACAGAGGTGGACATGAGGAAGATGGCGCTCTTGAACCTGGAGAGCAGCTGGGCTCAACACTGGAGAC

GTCTTCCTTAGGGGACACACTGACAAACGCTGCTGAACACCCTCCGGAGACAGCAAACCAAGACTCTACTTCCTCTCCGCAGCTTGGTGCGAAAAAATCC

CAGCCTGGTCCTTGTGAAATGATGACTCCCAAGAGATCCATCCGCGATTGCTTTAATTATAACGAGGACTCTCCCACGCAGCCCACATTGCCCAAAAGAG

GGCTATTTCTAAAAGAAACTCTTAAGAACGAGCGGAGAGGCAGTGATGGGAAGGGGAGGGTGGTTGACCTGAAGCCTGAGCTGAGCAGAAGCACCCCGTC

CCTGGTGGAACCCCCTGACAGATCGAAGCTCTGCCTAGTGTTGCAGTCTTCCTACCCCAGCAGCCCTTCTGCCGCCAGCCAGTCCTATGAGTGTTTGCAC

AAGGTGGGGATCGGCAATCTTGAAAACATAGTCAGAAGTCACATTAAAGAAATTTCTTCCAGTTTGGGAAGGCTTACTGACTGCCATAAAGAGAAACCGC

GACTGAAAAAGCCTCACAAGACCTTGGCCGAGGTGTCCCTGTGCAAAATACCTAAACGGGGAACTGGTTCAGGAAAGCAATCCGAGAATACCAGGAGCTC

AGTCGTGCCGACCATGGTGTCTCCTGGAGCTCCGAAAGCCACGGCGAGACCAGCAACAGATTCTGCGTCTACAACCTCAGGTGACACGTGCCATCAGAGA

AATCGGGGTGGAAAATTGCCAGCGCAGTCGAAGGCCTCCAGCTCATCCCCTTGTAGTCACAGCAGTGAGTCCTCTCTTGGCTCAGACAACATCAAATCCC

CACTTCCTCTCCTTTCAAAAAGCCAAAAAGGCTCCCCACCCGCTCCATGTCACGCCACACAGAACGGTCAGGTGGTGGAGGCCTGGTACGGCTCTGATGA

ATACCTAGCGCTGCCATCTCACCTCAAACAAACGGAGGTGTTAGCTCTGAAACTGGAGAACCTAACCAAGCTTCTACCCCAGAAACCCAGAGGAGAGACT

ATCCAGGATATTGATGACTGGGAACTGTCTGAGATGAATTCAGACTCTGAAATCTATCCAACGTACCATATCAAGAAAAAACACACAAGGCTAGGCACCG

TCTCTCCGAGCTCATCCAGCGACATAGCCTCATCTCTCGGGGAGAGCATTGAATCTGGGCCCCTGAGTGACATTCTTTCTGATGAGGACTTATGTATGCC

CCTCTCCGGCATGAAAAAGTTCACTGATGAGAAATCAGAGAGACCTTCATCCTCTGAGAAGAATGAGAGCCATTCTGCTACAAAATCAGCCTTAATTCAG

AAACTAATGAAAGATATTCAGCACCAAGATAACTATGAAGCCATCTGGGAAAGAATTGAG GGGTTTGTGAACAAGCTGGACGAATTCATTCAGTGGCTA

AACGAAGCCATGGAGACCACGGAGAACTGGACTCCGCCTAAAGCCGAGACCGACAGCCTCCGGCTGTACCTGGAGACACACTTG AGCTTTAAGTTGAAC

GTAGACAGTCACTGTGCCCTCAAGGAAGCCGTGGAGGAAGAAGGACACCAACTTCTTGAGCTCATTGCGTCTCACAAAGCAG GACTGAAGGACATGCTG

AAGATGATTGCAAGTCAATGGAAGGAGCTGCAGAGGCAAATCAAACGGCAACACAGCTGGATTCTCAGAGCCCTGGACACCATCAAAGCCGAGATACTGG

CTACTGATGTGTCTGTGGAGGACGAGGAGGGGACGGGGAGCCCCAAG GCTGAGGCTCAGCTCTGCTACCTGGAAGCTCAGAGAGACGCTGTGGAGCAGA

TGTCCCTCAAGCTGTACAGCGAGCAGTATACCAGTGGTAGCAAGAGGAAAGAAGAGTTTGCCGACATGTCGAAAGCGCATTCGGTGGGAAGCAATGG GC

TTCTGGACTTTGATTCAGAATATCAGGAGCTCTGGGATTGGCTGATTGACATGGAGTCCCTTGTGATGGACAGCCACGACCTGATGATGTCAGAGGAGCA

GCAGCAGCATCTTTACAAG CGCTACAGCGTGGAAATGTCCATCAGGCACCTGAAAAAGACAGAGCTACTTAGCAAGGTTGAAGCTTTGAAGAAAGGTGG

CCTTTCACTACCAAATGATATCCTGGAAAAAGTGGATTCAATTAATGAAAAATGGGAGCTGCTTGGG AAAACCCTAAGAGAGAAGATACAGGACACAAT

GGCAGGCCACAGTGGGTCGGGCCCACGTGACCTGCTCTCTCCTGAAAGCGGAAGCCTGGTAAGGCAGCTGGAGGTCAGGATCAAAGAGCTGAAAAGGTGG

CTAAGAGATACAGAGCTTTTCATCTTCAATTCCTGTCTGAGACAAGAGAAGGAAGGAACGAGCGCCGAGAAACAACTCCAATACTTTAAG TCGCTCTGT

CATGAGATCAAGCAGCGGCGTAGAGGAGTGGCCTCCATTCTGAGGTTGTGCCAGCACCTTCTGGATGACCGGGACACTTGTAATCTGAACGCAGATCACC

AGCCCATGCAGCTGATCATTGTAAACCTTGAAAGAAGGTGGGAAGCCATCGTCATGCAAGCTGTCCAGTGGCAAACACGGTTACGAAAGAAGATGGGAAA

AGAATCT ATAGCCTGGCTGAAGCTCGGGGCTGGCCTGACCCACCCTGGGCTGGTCTTGGGTTCCATCCTGTTATCATCACTGCCTCCTGCCACGTTGAC

TTCCTGAAGACGAACCTTCCTTCTGAATGCGGTCTGTCCACGTGGGCCTCCCGATATGGATGTGTGCATTGCTCCTCTTAGGTGATCGTCTTAGTTCCTC

AAAGCTGCTTGTTCTCCCGTGGATTCCTGTCCCAAGCTACCTCTGGCAACCCTCTCTCCAGCAAGACTTCTATTTTCCCTCTCTCCTCCCTCCTCCTTTT

AAAGCTCTGCAGTTCACCAAATTGATGGTCCATTAAACCCACTGTCTGGAATGACACCCCTCCCATCGGTACTTGACCAATTTTATGTTTTGCTCTGAAA

TTTTTCATGATATTATGCCTATGTTTATTGAAAGAGATTTACCTAAAAAGCCATCCCTTGATTTGATTGTAGTATAGAAGAGACACATTGATCCTTATGA

CAAAATTAAGTGATGTTTTGAAAGTGCCATTTTAATTATTTCTTTTTAATAATAATCTATGCAGCACTTCAAGAAACAACTATAACAGTGTTGTATAAAC

TGGTACATTCTACTATTAAGTTTGTTTTTGGTTTCTATGCTTCTTGAGGTGGTAATGAGAAAAATGTTTGTTTTTTTTTTTAAACGGTGTGCCTTGCTGT

ATTTCTTATACCATTTATTAAAAAGCTGCTTTTGTGGTAATATTATGTTGGTTTGAAAGGAGGAAATAGCAAGGTTAAGATGCGTGAATAATTTCTGTAT

ATATGTATAAGCTAATACAAACACTGATGTATGACAGTATAAAATGCTTTCATGTTTGTGATGTCCAGTGATGTGGAGAATATAAGCCTTAAACCCGTTC

GATTGCATGGTAATTAAAATTGGCATAATAAAAATAGCTTATTGGGGGAAAGGAAAATTAATGATCTCTTCTACCTGTGTTCTTTACCAAATTCTTGCAT

CTGGTTCTAGAAAAGAAAAAAGAATCAAACTCCATATATTAGCTTCCAAAATATCCATATTGCACAGAAGGCTTACATTGCTTAGACTACAGACTAGGCC

TGAAGCCTTCATAATTTTCAAAAATCTTTCTGTTTCACTATAAACATCCTGAAATAGCAAAGGTTTAAAGGCCATTTCCATCAACAATGTTTTATTCTAA

ATGTTTTTATTTCTACTTGCTAATGGTTTAATAATAGTTGTATTTGGAGATCTCTTACATGACCTAATTTATTTTAAATATTTGAATGGTTTTGGTGGAT

GGTATAGAAAATTTGATTATTATTTTATTTAAACTATAGATTTCAGGTATATTTATTTTGTTAAGAAAAATCAACAGAGGAATATTCCATTTGGTCTTTT

TTTTTTTTTGACTTGAAGAATTCAGCTTTTAATTTATATCATAACTCCTACTAAAGTGCCTGACACACAGTAGGTATTTCATAGAGTTTCCTGAATTTGA

GTATTGAGTGGGGTTTTACATATATATATTTATATATGTTTCCTGCATTAAAACTAGAAAAAGACGTGCAAAGTGAAGCACATCTATAATCACACATTTA

TAATCAGATTTCCAAAAGCCAATAGAACATGACAGACATATGTAGCCACCGAAATGACAATCATTCATTCAATAGATTACTCATTAGCATCTTTTGCCTG

CAAGTCACTATTCTATATTCAGGGAGAGCAGCTATGAACGATGCACTGCCTTTGGAGGTTTATCTATGTTTGAGACAGAGTGACTGACCACACAGACGTG

TGTGCCATAACGTCCCACAGATGAGGAAGAAAGCAAGTGTAGAGAAAGAGTCACAACGAGAGAGACAGCGGTGAGAGGCTGGGGCAAAGAGAAAGGCTAT

GGGAGAAGAGGGGTTAGCAGGGCTTCACTACATGTGTGAAAAGAGAGAAAGCCAAATAGAGAGACCTGCAAGATGTTTACAGAGCTGACATGGAGCGTTT

GTGTGCTGTGTAGTAGGTATAGGAGACCCAGTAGCTTGTGCGGGGCTTTATTTTATCCCACAATTGGAACTTTACTGGCGTCCTCCCAGGAACACTTAAA

TAATTTTGCGTGGATTTTGCCCCTTCTAATCTTTGCTGCACATATTTTTAAATGGATGGCTCATTCTAGGCTTTTGGGTATGTAGTGACTTCTTCCAACG

GAGTCTTAGAGAGACATCTAGTTATAGTGTTTATGAGGATCACAAAGGGGAGATGTTAGACATAACTATGTTGTAGGGGGAAAGAAAGGGGAAATTAGCT

AGATTTAAGGCAATGACAGAGTGCACAGGGATCGTAGCCTGAAATACAGAGAAAGACAGATCTTAGAGCCCTGAAAAGTATTTGAACATTTTTGGACCTC

TGTTAGGATATGGCATTATTTTATATACTGAGACAACCTGAATTTCTCTTAGTAAGTAATGTCAAGTCTAAGTCTATTGAAAAGACATTCAAAAAATTAA

TGGACCATGCTGGACTATTTGCCTCTTTTGTACTCATGAAGACTTAGAATTTGAAAATATTTATTAGTTATCTGCTTAACACTAACACCAAGTTGATCAG

GTTGACTCTTGAGTTTATTGATGCCTTTTCCAGCCAGAAGAGATGGAAGAGCCTCAGTCTCATACCCTGTGTAGACACTAACTTCCCATCTGCATTTGAA

AACAGCTCATTTGGTTTGTATTGATTTGATCAACACTATCTACGCATGTCCCATGACAATTGTTTGTTATTTGTTAAGGCAAAGTATCCCTCTTATGGGC

ATGTGTTTCTGTTAGAATGTGCTCTCTTAGGTTGCTAAATAAAGTCCACAGGGTACCCCTCCCCTTTTAGTTTGGTGTATTGGTCCTATGCCTGTGCTGC

AGAGAGGCCCTTAGAAGATTCCTGGTCCCTCTGTCTCATGGCCGCCCTTCAGGTAATTGAGAACAGTTACTCTCTTTCACAGGCAGTTCCTCCAACTGCC

CTTCATATATCATGACTTCAGATCCATTTCAACCTGACTGAATGTTAAACAGGCAGAACCCTTGATGTCAAGGGACTGTCTTCATCCTACATGTAGAGAG

GTGTGTGGACACTTAAGTGATAAGTTTTCTCAAAAATATATTCAAGATATATGTTTATTCTACTATTGTAAATTTCAATAAATAAACAAATAAACAAGTG

AATAAAATAAGAA
Translation
 - UNI32251 - MLTMSVTLSPLRSQDPDPMATDASPMAINMTPTVEQEEGEGEEAVKDVGAEQQYGKPPPLHTAADWKIVLHLPEIETWLRMTSERV

RDLTYSVQQDADSKHVDVHLVQLK DICEDISDHVEQIHALLETEFSLKLLSYSVNVIVDIHAVQLLWHQLRVSVLVLRERILQGLQDANGNYTRQTDIL

QAFSEETTE - UNI29899 - GRLDSLTEVDDSGQLTIKCSQNYLSLDCGITAFELSDYSPSEDLLGGLGDMTTSQAKTKSFDSWSYSEMEKEFPELI

RSVGLLTVATEPVPSSCGAANEDSSQVILSEDHRGGHEEDGALEPGEQLGSTLETSSLGDTLTNAAEHPPETANQDSTSSPQLGAKKSQPGPCEMMTPKR

SIRDCFNYNEDSPTQPTLPKRGLFLKETLKNERRGSDGKGRVVDLKPELSRSTPSLVEPPDRSKLCLVLQSSYPSSPSAASQSYECLHKVGIGNLENIVR

SHIKEISSSLGRLTDCHKEKPRLKKPHKTLAEVSLCKIPKRGTGSGKQSENTRSSVVPTMVSPGAPKATARPATDSASTTSGDTCHQRNRGGKLPAQSKA

SSSSPCSHSSESSLGSDNIKSPLPLLSKSQKGSPPAPCHATQNGQVVEAWYGSDEYLALPSHLKQTEVLALKLENLTKLLPQKPRGETIQDIDDWELSEM

NSDSEIYPTYHIKKKHTRLGTVSPSSSSDIASSLGESIESGPLSDILSDEDLCMPLSGMKKFTDEKSERPSSSEKNESHSATKSALIQKLMKDIQHQDNY

EAIWERIE GFVNKLDEFIQWLNEAMETTENWTPPKAETDSLRLYLETHL SFKLNVDSHCALKEAVEEEGHQLLELIASHKAG GLKDMLKMIASQWKE

LQRQIKRQHSWILRALDTIKAEILATDVSVEDEEGTGSPK AEAQLCYLEAQRDAVEQMSLKLYSEQYTSGSKRKEEFADMSKAHSVGSNG GLLDFDSE

YQELWDWLIDMESLVMDSHDLMMSEEQQQHLYK RYSVEMSIRHLKKTELLSKVEALKKGGLSLPNDILEKVDSINEKWELLG KTLREKIQDTMAGHSG

SGPRDLLSPESGSLVRQLEVRIKELKRWLRDTELFIFNSCLRQEKEGTSAEKQLQYFK SLCHEIKQRRRGVASILRLCQHLLDDRDTCNLNADHQPMQL

IIVNLERRWEAIVMQAVQWQTRLRKKMGKES IAWLKLGAGLTHPGLVLGSILLSSLPPATLTS

For any suggestions or comments, please send an email to unitrap@crg.es