Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000061887 (Ssbp3)
Chromosomal location
Chr 4: 106584075 - 106722298 (+)
Description
single-stranded DNA binding protein 3 Gene [Source:MGI (curated);Acc:Ssbp3-001]
RefSeq_dna
NM_198438 NM_023672 
RefSeq_peptide
NP_940840.1 NP_076161.2 
UniGene
Mm.413473 Mm.474861 Mm.195635 
MGI
MGI:1919725 
Uniprot/SWISSPROT
Q9D032 
Uniprot/SPTREMBL
B1AS33 Q3U5B9 Q8R051 B1AS34 B1AS36 B1AS37 B1AS35 Q8BMY2 
Human Ortholog
ENSG00000157216 (SSBP3)
Omim not available
UniTrap UNI16630
Vector Insertion
Chr 4: 106585872 - 106588249
Public Clones not available
Private Clones OST456617 (lexicon) OST190973 (lexicon) OST179275 (lexicon) OST172377 (lexicon)
OST148472 (lexicon) OST130160 (lexicon) OST125764 (lexicon) OST111697 (lexicon)
OST57255 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1821
Vector Insertion
Chr 4: 106588335 - 106622060
Public Clones CA0028 (sanger) AP0717 (sanger) AD0203 (sanger) XT0310 (sanger)
RRM120 (baygenomics) XB637 (baygenomics) RRS549 (baygenomics) IST14298D8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI15948
Vector Insertion
Chr 4: 106622151 - 106682283
Public Clones IST12584B9 (tigm) IST12351B2 (tigm) IST12840G1 (tigm) IST12845E4 (tigm)
IST14537G6 (tigm) IST10324A7 (tigm) IST14841E5 (tigm)
Private Clones OST469524 (lexicon) OST441317 (lexicon) OST374676 (lexicon) OST364159 (lexicon)
OST277558 (lexicon) OST147842 (lexicon) OST55774 (lexicon) OST378 (lexicon)
Severity of mutation (?) Insertion after 10% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4218
Vector Insertion
Chr 4: 106682374 - 106699821
Public Clones AL0427 (sanger) XB276 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 20% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18233
Vector Insertion
Chr 4: 106703534 - 106703619
Public Clones not available
Private Clones OST427115 (lexicon)
Severity of mutation (?) Insertion after 34% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28820
Vector Insertion
Chr 4: 106703697 - 106709540
Public Clones not available
Private Clones OST18984 (lexicon) OST14948 (lexicon)
Severity of mutation (?) Insertion after 43% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI20588
Vector Insertion
Chr 4: 106709606 - 106710206
Public Clones not available
Private Clones OST357850 (lexicon)
Severity of mutation (?) Insertion after 50% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18495
Vector Insertion
Chr 4: 106710256 - 106710826
Public Clones not available
Private Clones OST422507 (lexicon)
Severity of mutation (?) Insertion after 55% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI5595
Vector Insertion
Chr 4: 106711386 - 106712567
Public Clones YTA311 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 66% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000097933
Sequence
ATGTTGGTTGTTCACAGGCTGCAGGCTGTGTGGTTTTCTCCTCCTCAGCTGCTGGCAGGCGAGGGAAAGCTTTTTCCTGTTCTCAGATTG - UNI1594

8 - AGTGCAGCAGCTGCCCCAAGCCCTGTGCTTGGCAACATTCCCCCCAATGATGGGATGCCCGGAGGCCCCATCCCGCCAGGTTTCTTTCAG - UNI

4218 - CCTTTTATGTCACCGCGATATGCAGGCGGCCCCAGGCCCCCGATCAGAATGGGAAACCAG CCTCCAGGAGGAGTTCCTGGGACACAGCCACT

GCTGCCCAATTCCATGGATCCCACACGACAACAAG - UNI18233 - GTCACCCCAACATGGGAGGATCAATGCAGAGAATGAACCCTCCCCGAGGCA

TGGGGCCCATGGGGCCTGGCCCACAG - UNI28820 - AATTACGGCAGCGGCATGAGACCACCACCCAACTCCCTCGGCCCCGCCATGCCTGGGATT

AACAT - UNI20588 - GGGCCCAGGAGCTGGCAGACCCTGGCCCAATCCCAACAGTGCTAACTCA - UNI18495 - ATCCCGTACTCCTCATCA

TCACCCGGAACCTATGTG GGACCCCCTGGTGGTGGTGGCCCTCCAGGAACCCCCATCATGCCTAGTCCTGCAG - UNI5595 - ATTCAACAAATTC

CAGTGACAACATCTACACAATGATTAATCCTGTGCCGCCTGGAGGCAGCCGGTCTAAC TTTCCAATGGGTCCTGGCTCAGACGGCCCAATGGGAGGCAT

GGGCGGCATGGAGCCCCACCACATGAATGGATCCCTAG GATCAGGTGACATAGATGGACTTCCAAAA AATTCTCCTAACAACATAAGTGGCATTAGCA

ATCCTCCAGGCACCCCTCGCGATGACGGCGAGCTAGGGGGGAACTTCCTCCACTCCTTCCAGAACGACAAT TATTCTCCGAGCATGACGATGAGCGTGT

GACCCCCTCCGAGACGCTGGGAGCCAGCATTGCAGGCAGAAGATGCCAAGAATTATGCAAGAAGTGAGGTGTCCATACCAGGAGCTGGGGGAGGGCATCT

CCTGCTCCCTCCACCCTCCCATTCACTCCCCCACCTTCCCCAATTTTAGTTTCATGCAATAAAAAGGCCAAACTTTTATTCCGTAAAACATGAAGGACAA

AACTCAAAAATATATTTCAAGTCAACGGCCAGAAAACTCTCACCTTCTTCCCGCCCAAAAGGACCTTTCTGTACATGACACTTTTTGTTGGTTTTTTTGT

TTGTTTGGGATTTTACCGTTGCTGGGATTTTAAATTTGTTTTTTTTTTCCCGGGGTGGGGGGTGTTCTTTGGGGGAATTTTTTTTTTAATGGAAGCTTCT

AGCAAGCCCTATGCCCCACCCCAATCAACCTCTTTGCTTTCTTCTTTAAAAAAAGGAAAAAAGGAAAAAGAAAAAAAAGGAAAAAGAAAAAAAAGGCCAA

AAAAAAAAAAAAAAAAGGAAGAAAACCCCACAAGCCCTGCTGTCTGTCCCCAAGTCCTACCACCAGAAAAGCTGGTCTAGGTGTGCAGTGTCACACTGAC

GTTGTAGCCATCTAAAATAATAATAATAAACTGGACAGTTTGCAATTGCTGGTTTATTTCAAAAGCTGTTTGGGGAAAAGGAACAGAAACCAACCCTTTC

CACATGGGCCTTGGGGTTTGCAAAGCTGGGCGAGGAGATGCAGGTGTCAGCTTTGCTCTGGCTTGACTGGCCATCACAACACACTGGGCCAGAGGACCCA

GAGCCTGCTGTCACCCAACAGAGACCATCGCTGTGATCCAGCGTACACACTGTTCCAGGATGGCTGCCTCTTCTCCAGACCTCTCGTGCCAAGCCACTGG

GGCCTCCAGTCTTTCGATCCCCACCGTTTCCTGGCAAGAGTCCTGCTGGCTGGGTAGTGGCCCAGGCCAAGGAGGAGAGGCCCCGCCAACGGGATGACTA

CAATCTGGGCCATAGCCCTGACCTCCATATTCTGGTCCCGAGCTCCTCACATAGTGCGCACTGGCAGGGCAGGCTGAGGTTGTGGTTTTCTTTTTTTTCC

TCCTGTTTGTCCTTTTTCAGAGATGGGTGTTGGTTGGAATTGCTCTGTATTTGCTTGGGACTGGATGGACAGACTTCGGCATTGCTGTGGGGGTGGGGGA

GCACCAGCAACCAAACAGACACTGTTTCTGGTCCTGTTTTTATTTTCAAAAACCGATGAACCTGATGATGGAGCCTGTCCCCTCCGAGGAGGGGTGACTT

GGCTGCCCTGGCCTCTCCCCGTGGCAACCTTTGTGTCTTGCCCCGGAAGACACTGAGTTCATTGTACATGTACACCCTCTGCGCCCTGCCCACCCTTGTA

GCTGGTCTTTGTTTTCTTACCTCCCCTTTCTGACCCATGTATATCATATTATGTGAGATACCATCTGCCTGAAAAAAGACCTTGTGCGGATTCTTGGGAA

CATTGTAGCTGTTTCTGTGTTTTTTCTTACCTTGTAGTCTGGTTCTGAATTATGAGAGGAAAAAAAAAGTAATTATGATACATTGTAGTTTGTGTACGAT

ATATGTTGATAACGTTTTATTAAAGGGACATCTTTTTTCCGC
Translation
MLVVHRLQAVWFSPPQLLAGEGKLFPVLRL - UNI15948 - SAAAAPSPVLGNIPPNDGMPGGPIPPGFFQ - UNI4218 - PFMSPRYAGGPRP

PIRMGNQ PPGGVPGTQPLLPNSMDPTRQQG - UNI18233 - GHPNMGGSMQRMNPPRGMGPMGPGPQ - UNI28820 - NYGSGMRPPPNSLGP

AMPGINM - UNI20588 - MGPGAGRPWPNPNSANS - UNI18495 - IPYSSSSPGTYV GPPGGGGPPGTPIMPSPAD - UNI5595 - DST

NSSDNIYTMINPVPPGGSRSN FPMGPGSDGPMGGMGGMEPHHMNGSLG GSGDIDGLPK NSPNNISGISNPPGTPRDDGELGGNFLHSFQNDN YSPS

MTMSV
Transcript ENSMUST00000106761
Sequence
AGCCACGTTCGGTTGAGCTCCAAGTAGACCAGCGGCGGCGGCGGCGGCAGCGGCAGCGGTGCTGAAGGCGCAGAGGGCGGCGCAGGCGGAGCCGGGCGGC

GGGCGCGCGGGCCGCGAGCAAGCGAGCTGCAGGCTTCGGGCGGGCGGCGGCGCAGCTCAGGCCGAGCCGGCGCGGGAGGAGTTCCAGGGCGATGGGGCCG

CGGCCGGGGCTGACGCTTTGACAGCTGGAAAGAGCGCGGAGCCTGCGCCTGGGAGGGAGGGAGCGCGGCGAGCGGAGTGCGAGCGAGCGGGCGAGCGCCG

GGAGGGGGCCGGGAGCAGGGCAGCTCGGGAGACCGGACGGTAGCGGCGGCGGCGGCGGCGGGCTCGGCGCCCTCTTCTCTGCAAGCCATGTTTGCCAAAG

GCAAAGGCTCGGCGGTGCCCTCGGACGGGCAGGCTCGGGAAAA GTTAGCTTTATACGTCTACGAATATTTACTGCACGTAGGAGCACAGAAATCTGCAC

AGACCTTCTTATCAGAG ATTCGATGGGAAAAAAACATCACACTGGGTGAACCGCCTGGGTTCCTGCACTCGTGGTGGTG - UNI16630 - TGTATT

TTGGGACCTTTACTGTGCAGCTCCTGAAAGGAGAGACACTTGTGAACATTCAAGTGAAGCAAAAGCCTTTCATGATTAT - UNI1821 - - UNI159

48 - AGTGCAGCAGCTGCCCCAAGCCCTGTGCTTGGCAACATTCCCCCCAATGATGGGATGCCCGGAGGCCCCATCCCGCCAGGTTTCTTTCAG - UN

I4218 - CCTCCAGGAGGAGTTCCTGGGACACAGCCACTGCTGCCCAATTCCATGGATCCCACACGACAACAAG - UNI18233 - GTCACCCCAAC

ATGGGAGGATCAATGCAGAGAATGAACCCTCCCCGAGGCATGGGGCCCATGGGGCCTGGCCCACAG - UNI28820 - AATTACGGCAGCGGCATGAG

ACCACCACCCAACTCCCTCGGCCCCGCCATGCCTGGGATTAACAT - UNI20588 - GGGCCCAGGAGCTGGCAGACCCTGGCCCAATCCCAACAGTG

CTAACTCA - UNI18495 - ATCCCGTACTCCTCATCATCACCCGGAACCTATGTG GGACCCCCTGGTGGTGGTGGCCCTCCAGGAACCCCCATCAT

GCCTAGTCCTGCAG - UNI5595 - ATTCAACAAATTCCAGTGACAACATCTACACAATGATTAATCCTGTGCCGCCTGGAGGCAGCCGGTCTAAC T

TTCCAATGGGTCCTGGCTCAGACGGCCCAATGGGAGGCATGGGCGGCATGGAGCCCCACCACATGAATGGATCCCTAG GATCAGGTGACATAGATGGAC

TTCCAAAA AATTCTCCTAACAACATAAGTGGCATTAGCAATCCTCCAGGCACCCCTCGCGATGACGGCGAGCTAGGGGGGAACTTCCTCCACTCCTTCC

AGAACGACAAT TATTCTCCGAGCATGACGATGAGCGTGTGACCCCCTCCGAGACGCTGGGAGCCAGCATTGCAGGCAGAAGATGCCAAGAATTATGCAA

GAAGTGAGGTGTCCATACCAGGAGCTGGGGGAGGGCATCTCCTGCTCCCTCCACCCTCCCATTCACTCCCCCACCTTCCCCAATTTTAGTTTCATGCAAT

AAAAAGGCCAAACTTTTATTCCGTAAAACATGAAGGACAAAACTCAAAAATATATTTCAAGTCAACGGCCAGAAAACTCTCACCTTCTTCCCGCCCAAAA

GGACCTTTCTGTACATGACACTTTTTGTTGGTTTTTTTGTTTGTTTGGGATTTTACCGTTGCTGGGATTTTAAATTTGTTTTTTTTTTCCCGGGGTGGGG

GGTGTTCTTTGGGGGAATTTTTTTTTTAATGGAAGCTTCTAGCAAGCCCTATGCCCCACCCCAATCAACCTCTTTGCTTTCTTCTTTAAAAAAAGGAAAA

AAGGAAAAAGAAAAAAAAGGAAAAAGAAAAAAAAGGCCAAAAAAAAAAAAAAAAAAGGAAGAAAACCCCACAAGCCCTGCTGTCTGTCCCCAAGTCCTAC

CACCAGAAAAGCTGGTCTAGGTGTGCAGTGTCACACTGACGTTGTAGCCATCTAAAATAATAATAATAAACTGGACAGTTTGCAATTGCTGGTTTATTTC

AAAAGCTGTTTGGGGAAAAGGAACAGAAACCAACCCTTTCCACATGGGCCTTGGGGTTTGCAAAGCTGGGCGAGGAGATGCAGGTGTCAGCTTTGCTCTG

GCTTGACTGGCCATCACAACACACTGGGCCAGAGGACCCAGAGCCTGCTGTCACCCAACAGAGACCATCGCTGTGATCCAGCGTACACACTGTTCCAGGA

TGGCTGCCTCTTCTCCAGACCTCTCGTGCCAAGCCACTGGGGCCTCCAGTCTTTCGATCCCCACCGTTTCCTGGCAAGAGTCCTGCTGGCTGGGTAGTGG

CCCAGGCCAAGGAGGAGAGGCCCCGCCAACGGGATGACTACAATCTGGGCCATAGCCCTGACCTCCATATTCTGGTCCCGAGCTCCTCACATAGTGCGCA

CTGGCAGGGCAGGCTGAGGTTGTGGTTTTCTTTTTTTTCCTCCTGTTTGTCCTTTTTCAGAGATGGGTGTTGGTTGGAATTGCTCTGTATTTGCTTGGGA

CTGGATGGACAGACTTCGGCATTGCTGTGGGGGTGGGGGAGCACCAGCAACCAAACAGACACTGTTTCTGGTCCTGTTTTTATTTTCAAAAACCGATGAA

CCTGATGATGGAGCCTGTCCCCTCCGAGGAGGGGTGACTTGGCTGCCCTGGCCTCTCCCCGTGGCAACCTTTGTGTCTTGCCCCGGAAGACACTGAGTTC

ATTGTACATGTACACCCTCTGCGCCCTGCCCACCCTTGTAGCTGGTCTTTGTTTTCTTACCTCCCCTTTCTGACCCATGTATATCATATTATGTGAGATA

CCATCTGCCTGAAAAAAGACCTTGTGCGGATTCTTGGGAACATTGTAGCTGTTTCTGTGTTTTTTCTTACCTTGTAGTCTGGTTCTGAATTATGAGAGGA

AAAAAAAAGTAATTATGATACATTGTAGTTTGTGTACGATATATGTTGATAACGTTTTATTAAAGGGACATCTTTTTTCCGC
Translation
MFAKGKGSAVPSDGQAREK KLALYVYEYLLHVGAQKSAQTFLSE IRWEKNITLGEPPGFLHSWWC - UNI16630 - CVFWDLYCAAPERRDTCEH

SSEAKAFHDY - UNI1821 - - UNI15948 - SAAAAPSPVLGNIPPNDGMPGGPIPPGFFQ - UNI4218 - PPGGVPGTQPLLPNSMDPTRQ

QG - UNI18233 - GHPNMGGSMQRMNPPRGMGPMGPGPQ - UNI28820 - NYGSGMRPPPNSLGPAMPGINM - UNI20588 - MGPGAGRP

WPNPNSANS - UNI18495 - IPYSSSSPGTYV GPPGGG - UNI5595 -     
Transcript ENSMUST00000072753
Sequence
AGCCACGTTCGGTTGAGCTCCAAGTAGACCAGCGGCGGCGGCGGCGGCAGCGGCAGCGGTGCTGAAGGCGCAGAGGGCGGCGCAGGCGGAGCCGGGCGGC

GGGCGCGCGGGCCGCGAGCAAGCGAGCTGCAGGCTTCGGGCGGGCGGCGGCGCAGCTCAGGCCGAGCCGGCGCGGGAGGAGTTCCAGGGCGATGGGGCCG

CGGCCGGGGCTGACGCTTTGACAGCTGGAAAGAGCGCGGAGCCTGCGCCTGGGAGGGAGGGAGCGCGGCGAGCGGAGTGCGAGCGAGCGGGCGAGCGCCG

GGAGGGGGCCGGGAGCAGGGCAGCTCGGGAGACCGGACGGTAGCGGCGGCGGCGGCGGCGGGCTCGGCGCCCTCTTCTCTGCAAGCCATGTTTGCCAAAG

GCAAAGGCTCGGCGGTGCCCTCGGACGGGCAGGCTCGGGAAAA GTTAGCTTTATACGTCTACGAATATTTACTGCACGTAGGAGCACAGAAATCTGCAC

AGACCTTCTTATCAGAG ATTCGATGGGAAAAAAACATCACACTGGGTGAACCGCCTGGGTTCCTGCACTCGTGGTGGTG - UNI16630 - TGTATT

TTGGGACCTTTACTGTGCAGCTCCTGAAAGGAGAGACACTTGTGAACATTCAAGTGAAGCAAAAGCCTTTCATGATTAT - UNI1821 - - UNI159

48 - AGTGCAGCAGCTGCCCCAAGCCCTGTGCTTGGCAACATTCCCCCCAATGATGGGATGCCCGGAGGCCCCATCCCGCCAGGTTTCTTTCAG - UN

I4218 - CCTTTTATGTCACCGCGATATGCAGGCGGCCCCAGGCCCCCGATCAGAATGGGAAACCAG CCTCCAGGAGGAGTTCCTGGGACACAGCCAC

TGCTGCCCAATTCCATGGATCCCACACGACAACAAG - UNI18233 - GTCACCCCAACATGGGAGGATCAATGCAGAGAATGAACCCTCCCCGAGGC

ATGGGGCCCATGGGGCCTGGCCCACAG - UNI28820 - AATTACGGCAGCGGCATGAGACCACCACCCAACTCCCTCGGCCCCGCCATGCCTGGGAT

TAACAT - UNI20588 - GGGCCCAGGAGCTGGCAGACCCTGGCCCAATCCCAACAGTGCTAACTCA - UNI18495 - ATCCCGTACTCCTCATC

ATCACCCGGAACCTATGTG GGACCCCCTGGTGGTGGTGGCCCTCCAGGAACCCCCATCATGCCTAGTCCTGCAG - UNI5595 - ATTCAACAAATT

CCAGTGACAACATCTACACAATGATTAATCCTGTGCCGCCTGGAGGCAGCCGGTCTAAC TTTCCAATGGGTCCTGGCTCAGACGGCCCAATGGGAGGCA

TGGGCGGCATGGAGCCCCACCACATGAATGGATCCCTAG GATCAGGTGACATAGATGGACTTCCAAAA AATTCTCCTAACAACATAAGTGGCATTAGC

AATCCTCCAGGCACCCCTCGCGATGACGGCGAGCTAGGGGGGAACTTCCTCCACTCCTTCCAGAACGACAAT TATTCTCCGAGCATGACGATGAGCGTG

TGACCCCCTCCGAGACGCTGGGAGCCAGCATTGCAGGCAGAAGATGCCAAGAATTATGCAAGAAGTGAGGTGTCCATACCAGGAGCTGGGGGAGGGCATC

TCCTGCTCCCTCCACCCTCCCATTCACTCCCCCACCTTCCCCAATTTTAGTTTCATGCAATAAAAAGGCCAAACTTTTATTCCGTAAAACATGAAGGACA

AAACTCAAAAATATATTTCAAGTCAACGGCCAGAAAACTCTCACCTTCTTCCCGCCCAAAAGGACCTTTCTGTACATGACACTTTTTGTTGGTTTTTTTG

TTTGTTTGGGATTTTACCGTTGCTGGGATTTTAAATTTGTTTTTTTTTTCCCGGGGTGGGGGGTGTTCTTTGGGGGAATTTTTTTTTTAATGGAAGCTTC

TAGCAAGCCCTATGCCCCACCCCAATCAACCTCTTTGCTTTCTTCTTTAAAAAAAGGAAAAAAGGAAAAAGAAAAAAAAGGAAAAAGAAAAAAAAGGCCA

AAAAAAAAAAAAAAAAAGGAAGAAAACCCCACAAGCCCTGCTGTCTGTCCCCAAGTCCTACCACCAGAAAAGCTGGTCTAGGTGTGCAGTGTCACACTGA

CGTTGTAGCCATCTAAAATAATAATAATAAACTGGACAGTTTGCAATTGCTGGTTTATTTCAAAAGCTGTTTGGGGAAAAGGAACAGAAACCAACCCTTT

CCACATGGGCCTTGGGGTTTGCAAAGCTGGGCGAGGAGATGCAGGTGTCAGCTTTGCTCTGGCTTGACTGGCCATCACAACACACTGGGCCAGAGGACCC

AGAGCCTGCTGTCACCCAACAGAGACCATCGCTGTGATCCAGCGTACACACTGTTCCAGGATGGCTGCCTCTTCTCCAGACCTCTCGTGCCAAGCCACTG

GGGCCTCCAGTCTTTCGATCCCCACCGTTTCCTGGCAAGAGTCCTGCTGGCTGGGTAGTGGCCCAGGCCAAGGAGGAGAGGCCCCGCCAACGGGATGACT

ACAATCTGGGCCATAGCCCTGACCTCCATATTCTGGTCCCGAGCTCCTCACATAGTGCGCACTGGCAGGGCAGGCTGAGGTTGTGGTTTTCTTTTTTTTC

CTCCTGTTTGTCCTTTTTCAGAGATGGGTGTTGGTTGGAATTGCTCTGTATTTGCTTGGGACTGGATGGACAGACTTCGGCATTGCTGTGGGGGTGGGGG

AGCACCAGCAACCAAACAGACACTGTTTCTGGTCCTGTTTTTATTTTCAAAAACCGATGAACCTGATGATGGAGCCTGTCCCCTCCGAGGAGGGGTGACT

TGGCTGCCCTGGCCTCTCCCCGTGGCAACCTTTGTGTCTTGCCCCGGAAGACACTGAGTTCATTGTACATGTACACCCTCTGCGCCCTGCCCACCCTTGT

AGCTGGTCTTTGTTTTCTTACCTCCCCTTTCTGACCCATGTATATCATATTATGTGAGATACCATCTGCCTGAAAAAAGACCTTGTGCGGATTCTTGGGA

ACATTGTAGCTGTTTCTGTGTTTTTTCTTACCTTGTAGTCTGGTTCTGAATTATGAGAGGAAAAAAAAAGTAATTATGATACATTGTAGTTTGTGTACGA

TATATGTTGATAACGTTTTATTAAAGGGACATCTTTTTTCCGC
Translation
MFAKGKGSAVPSDGQAREK KLALYVYEYLLHVGAQKSAQTFLSE IRWEKNITLGEPPGFLHSWWC - UNI16630 - CVFWDLYCAAPERRDTCEH

SSEAKAFHDY - UNI1821 - - UNI15948 - SAAAAPSPVLGNIPPNDGMPGGPIPPGFFQ - UNI4218 - PFMSPRYAGGPRPPIRMGNQ 

PPGGVPGTQPLLPNSMDPTRQQG - UNI18233 - GHPNMGGSMQRMNPPRGMGPMGPGPQ - UNI28820 - NYGSGMRPPPNSLGPAMPGINM 

- UNI20588 - MGPGAGRPWPNPNSANS - UNI18495 - IPYSSSSPGTYV GPPGGGGPPGTPIMPSPAD - UNI5595 - DSTNSSDNIYT

MINPVPPGGSRSN FPMGPGSDGPMGGMGGMEPHHMNGSLG GSGDIDGLPK NSPNNISGISNPPGTPRDDGELGGNFLHSFQNDN YSPSMTMSV
Transcript ENSMUST00000097934
Sequence
AGCCACGTTCGGTTGAGCTCCAAGTAGACCAGCGGCGGCGGCGGCGGCAGCGGCAGCGGTGCTGAAGGCGCAGAGGGCGGCGCAGGCGGAGCCGGGCGGC

GGGCGCGCGGGCCGCGAGCAAGCGAGCTGCAGGCTTCGGGCGGGCGGCGGCGCAGCTCAGGCCGAGCCGGCGCGGGAGGAGTTCCAGGGCGATGGGGCCG

CGGCCGGGGCTGACGCTTTGACAGCTGGAAAGAGCGCGGAGCCTGCGCCTGGGAGGGAGGGAGCGCGGCGAGCGGAGTGCGAGCGAGCGGGCGAGCGCCG

GGAGGGGGCCGGGAGCAGGGCAGCTCGGGAGACCGGACGGTAGCGGCGGCGGCGGCGGCGGGCTCGGCGCCCTCTTCTCTGCAAGCCATGTTTGCCAAAG

GCAAAGGCTCGGCGGTGCCCTCGGACGGGCAGGCTCGGGAAAA GTTAGCTTTATACGTCTACGAATATTTACTGCACGTAGGAGCACAGAAATCTGCAC

AGACCTTCTTATCAGAG ATTCGATGGGAAAAAAACATCACACTGGGTGAACCGCCTGGGTTCCTGCACTCGTGGTGGTG - UNI16630 - TGTATT

TTGGGACCTTTACTGTGCAGCTCCTGAAAGGAGAGACACTTGTGAACATTCAAGTGAAGCAAAAGCCTTTCATGATTAT - UNI1821 - - UNI159

48 - AGTGCAGCAGCTGCCCCAAGCCCTGTGCTTGGCAACATTCCCCCCAATGATGGGATGCCCGGAGGCCCCATCCCGCCAGGTTTCTTTCAG - UN

I4218 - GGTCCTCCGGGGTCACAGCCCTCGCCGCACGCACAGCCTCCACCTCACAATCCCAGCAGCATGATGGGACCCCACAGTCAG CCTCCAGGAG

GAGTTCCTGGGACACAGCCACTGCTGCCCAATTCCATGGATCCCACACGACAACAAG - UNI18233 - GTCACCCCAACATGGGAGGATCAATGCAG

AGAATGAACCCTCCCCGAGGCATGGGGCCCATGGGGCCTGGCCCACAG - UNI28820 - AATTACGGCAGCGGCATGAGACCACCACCCAACTCCCT

CGGCCCCGCCATGCCTGGGATTAACAT - UNI20588 - GGGCCCAGGAGCTGGCAGACCCTGGCCCAATCCCAACAGTGCTAACTCA - UNI1849

5 - ATCCCGTACTCCTCATCATCACCCGGAACCTATGTG GGACCCCCTGGTGGTGGTGGCCCTCCAGGAACCCCCATCATGCCTAGTCCTGCAG - U

NI5595 - ATTCAACAAATTCCAGTGACAACATCTACACAATGATTAATCCTGTGCCGCCTGGAGGCAGCCGGTCTAAC TTTCCAATGGGTCCTGGCT

CAGACGGCCCAATGGGAGGCATGGGCGGCATGGAGCCCCACCACATGAATGGATCCCTAG GATCAGGTGACATAGATGGACTTCCAAAA AATTCTCCT

AACAACATAAGTGGCATTAGCAATCCTCCAGGCACCCCTCGCGATGACGGCGAGCTAGGGGGGAACTTCCTCCACTCCTTCCAGAACGACAAT TATTCT

CCGAGCATGACGATGAGCGTGTGACCCCCTCCGAGACGCTGGGAGCCAGCATTGCAGGCAGAAGATGCCAAGAATTATGCAAGAAGTGAGGTGTCCATAC

CAGGAGCTGGGGGAGGGCATCTCCTGCTCCCTCCACCCTCCCATTCACTCCCCCACCTTCCCCAATTTTAGTTTCATGCAATAAAAAGGCCAAACTTTTA

TTCCGTAAAACATGAAGGACAAAACTCAAAAATATATTTCAAGTCAACGGCCAGAAAACTCTCACCTTCTTCCCGCCCAAAAGGACCTTTCTGTACATGA

CACTTTTTGTTGGTTTTTTTGTTTGTTTGGGATTTTACCGTTGCTGGGATTTTAAATTTGTTTTTTTTTTCCCGGGGTGGGGGGTGTTCTTTGGGGGAAT

TTTTTTTTTAATGGAAGCTTCTAGCAAGCCCTATGCCCCACCCCAATCAACCTCTTTGCTTTCTTCTTTAAAAAAAGGAAAAAAGGAAAAAGAAAAAAAA

GGAAAAAGAAAAAAAAGGCCAAAAAAAAAAAAAAAAAAGGAAGAAAACCCCACAAGCCCTGCTGTCTGTCCCCAAGTCCTACCACCAGAAAAGCTGGTCT

AGGTGTGCAGTGTCACACTGACGTTGTAGCCATCTAAAATAATAATAATAAACTGGACAGTTTGCAATTGCTGGTTTATTTCAAAAGCTGTTTGGGGAAA

AGGAACAGAAACCAACCCTTTCCACATGGGCCTTGGGGTTTGCAAAGCTGGGCGAGGAGATGCAGGTGTCAGCTTTGCTCTGGCTTGACTGGCCATCACA

ACACACTGGGCCAGAGGACCCAGAGCCTGCTGTCACCCAACAGAGACCATCGCTGTGATCCAGCGTACACACTGTTCCAGGATGGCTGCCTCTTCTCCAG

ACCTCTCGTGCCAAGCCACTGGGGCCTCCAGTCTTTCGATCCCCACCGTTTCCTGGCAAGAGTCCTGCTGGCTGGGTAGTGGCCCAGGCCAAGGAGGAGA

GGCCCCGCCAACGGGATGACTACAATCTGGGCCATAGCCCTGACCTCCATATTCTGGTCCCGAGCTCCTCACATAGTGCGCACTGGCAGGGCAGGCTGAG

GTTGTGGTTTTCTTTTTTTTCCTCCTGTTTGTCCTTTTTCAGAGATGGGTGTTGGTTGGAATTGCTCTGTATTTGCTTGGGACTGGATGGACAGACTTCG

GCATTGCTGTGGGGGTGGGGGAGCACCAGCAACCAAACAGACACTGTTTCTGGTCCTGTTTTTATTTTCAAAAACCGATGAACCTGATGATGGAGCCTGT

CCCCTCCGAGGAGGGGTGACTTGGCTGCCCTGGCCTCTCCCCGTGGCAACCTTTGTGTCTTGCCCCGGAAGACACTGAGTTCATTGTACATGTACACCCT

CTGCGCCCTGCCCACCCTTGTAGCTGGTCTTTGTTTTCTTACCTCCCCTTTCTGACCCATGTATATCATATTATGTGAGATACCATCTGCCTGAAAAAAG

ACCTTGTGCGGATTCTTGGGAACATTGTAGCTGTTTCTGTGTTTTTTCTTACCTTGTAGTCTGGTTCTGAATTATGAGAGGAAAAAAAAAGTAATTATGA

TACATTGTAGTTTGTGTACGATATATGTTGATAACGTTTTATTAAAGGGACATCTTTTTTCCGC
Translation
MFAKGKGSAVPSDGQAREK KLALYVYEYLLHVGAQKSAQTFLSE IRWEKNITLGEPPGFLHSWWC - UNI16630 - CVFWDLYCAAPERRDTCEH

SSEAKAFHDY - UNI1821 - - UNI15948 - SAAAAPSPVLGNIPPNDGMPGGPIPPGFFQ - UNI4218 - GPPGSQPSPHAQPPPHNPSSM

MGPHSQ PPGGVPGTQPLLPNSMDPTRQQG - UNI18233 - GHPNMGGSMQRMNPPRGMGPMGPGPQ - UNI28820 - NYGSGMRPPPNSLGPA

MPGINM - UNI20588 - MGPGAGRPWPNPNSANS - UNI18495 - IPYSSSSPGTYV GPPGGGGPPGTPIMPSPAD - UNI5595 - DSTN

SSDNIYTMINPVPPGGSRSN FPMGPGSDGPMGGMGGMEPHHMNGSLG GSGDIDGLPK NSPNNISGISNPPGTPRDDGELGGNFLHSFQNDN YSPSM

TMSV
Transcript ENSMUST00000030367
Sequence
AGCCACGTTCGGTTGAGCTCCAAGTAGACCAGCGGCGGCGGCGGCGGCAGCGGCAGCGGTGCTGAAGGCGCAGAGGGCGGCGCAGGCGGAGCCGGGCGGC

GGGCGCGCGGGCCGCGAGCAAGCGAGCTGCAGGCTTCGGGCGGGCGGCGGCGCAGCTCAGGCCGAGCCGGCGCGGGAGGAGTTCCAGGGCGATGGGGCCG

CGGCCGGGGCTGACGCTTTGACAGCTGGAAAGAGCGCGGAGCCTGCGCCTGGGAGGGAGGGAGCGCGGCGAGCGGAGTGCGAGCGAGCGGGCGAGCGCCG

GGAGGGGGCCGGGAGCAGGGCAGCTCGGGAGACCGGACGGTAGCGGCGGCGGCGGCGGCGGGCTCGGCGCCCTCTTCTCTGCAAGCCATGTTTGCCAAAG

GCAAAGGCTCGGCGGTGCCCTCGGACGGGCAGGCTCGGGAAAA GTTAGCTTTATACGTCTACGAATATTTACTGCACGTAGGAGCACAGAAATCTGCAC

AGACCTTCTTATCAGAG ATTCGATGGGAAAAAAACATCACACTGGGTGAACCGCCTGGGTTCCTGCACTCGTGGTGGTG - UNI16630 - TGTATT

TTGGGACCTTTACTGTGCAGCTCCTGAAAGGAGAGACACTTGTGAACATTCAAGTGAAGCAAAAGCCTTTCATGATTAT - UNI1821 - - UNI159

48 - AGTGCAGCAGCTGCCCCAAGCCCTGTGCTTGGCAACATTCCCCCCAATGATGGGATGCCCGGAGGCCCCATCCCGCCAGGTTTCTTTCAG - UN

I4218 - GGTCCTCCGGGGTCACAGCCCTCGCCGCACGCACAGCCTCCACCTCACAATCCCAGCAGCATGATGGGACCCCACAGTCAG CCTTTTATGT

CACCGCGATATGCAGGCGGCCCCAGGCCCCCGATCAGAATGGGAAACCAG CCTCCAGGAGGAGTTCCTGGGACACAGCCACTGCTGCCCAATTCCATGG

ATCCCACACGACAACAAG - UNI18233 - GTCACCCCAACATGGGAGGATCAATGCAGAGAATGAACCCTCCCCGAGGCATGGGGCCCATGGGGCCT

GGCCCACAG - UNI28820 - AATTACGGCAGCGGCATGAGACCACCACCCAACTCCCTCGGCCCCGCCATGCCTGGGATTAACAT - UNI20588 

- GGGCCCAGGAGCTGGCAGACCCTGGCCCAATCCCAACAGTGCTAACTCA - UNI18495 - ATCCCGTACTCCTCATCATCACCCGGAACCTATGT

G GGACCCCCTGGTGGTGGTGGCCCTCCAGGAACCCCCATCATGCCTAGTCCTGCAG - UNI5595 - ATTCAACAAATTCCAGTGACAACATCTACA

CAATGATTAATCCTGTGCCGCCTGGAGGCAGCCGGTCTAAC TTTCCAATGGGTCCTGGCTCAGACGGCCCAATGGGAGGCATGGGCGGCATGGAGCCCC

ACCACATGAATGGATCCCTAG GATCAGGTGACATAGATGGACTTCCAAAA AATTCTCCTAACAACATAAGTGGCATTAGCAATCCTCCAGGCACCCCT

CGCGATGACGGCGAGCTAGGGGGGAACTTCCTCCACTCCTTCCAGAACGACAAT TATTCTCCGAGCATGACGATGAGCGTGTGACCCCCTCCGAGACGC

TGGGAGCCAGCATTGCAGGCAGAAGATGCCAAGAATTATGCAAGAAGTGAGGTGTCCATACCAGGAGCTGGGGGAGGGCATCTCCTGCTCCCTCCACCCT

CCCATTCACTCCCCCACCTTCCCCAATTTTAGTTTCATGCAATAAAAAGGCCAAACTTTTATTCCGTAAAACATGAAGGACAAAACTCAAAAATATATTT

CAAGTCAACGGCCAGAAAACTCTCACCTTCTTCCCGCCCAAAAGGACCTTTCTGTACATGACACTTTTTGTTGGTTTTTTTGTTTGTTTGGGATTTTACC

GTTGCTGGGATTTTAAATTTGTTTTTTTTTTCCCGGGGTGGGGGGTGTTCTTTGGGGGAATTTTTTTTTTAATGGAAGCTTCTAGCAAGCCCTATGCCCC

ACCCCAATCAACCTCTTTGCTTTCTTCTTTAAAAAAAGGAAAAAAGGAAAAAGAAAAAAAAGGAAAAAGAAAAAAAAGGCCAAAAAAAAAAAAAAAAAAG

GAAGAAAACCCCACAAGCCCTGCTGTCTGTCCCCAAGTCCTACCACCAGAAAAGCTGGTCTAGGTGTGCAGTGTCACACTGACGTTGTAGCCATCTAAAA

TAATAATAATAAACTGGACAGTTTGCAATTGCTGGTTTATTTCAAAAGCTGTTTGGGGAAAAGGAACAGAAACCAACCCTTTCCACATGGGCCTTGGGGT

TTGCAAAGCTGGGCGAGGAGATGCAGGTGTCAGCTTTGCTCTGGCTTGACTGGCCATCACAACACACTGGGCCAGAGGACCCAGAGCCTGCTGTCACCCA

ACAGAGACCATCGCTGTGATCCAGCGTACACACTGTTCCAGGATGGCTGCCTCTTCTCCAGACCTCTCGTGCCAAGCCACTGGGGCCTCCAGTCTTTCGA

TCCCCACCGTTTCCTGGCAAGAGTCCTGCTGGCTGGGTAGTGGCCCAGGCCAAGGAGGAGAGGCCCCGCCAACGGGATGACTACAATCTGGGCCATAGCC

CTGACCTCCATATTCTGGTCCCGAGCTCCTCACATAGTGCGCACTGGCAGGGCAGGCTGAGGTTGTGGTTTTCTTTTTTTTCCTCCTGTTTGTCCTTTTT

CAGAGATGGGTGTTGGTTGGAATTGCTCTGTATTTGCTTGGGACTGGATGGACAGACTTCGGCATTGCTGTGGGGGTGGGGGAGCACCAGCAACCAAACA

GACACTGTTTCTGGTCCTGTTTTTATTTTCAAAAACCGATGAACCTGATGATGGAGCCTGTCCCCTCCGAGGAGGGGTGACTTGGCTGCCCTGGCCTCTC

CCCGTGGCAACCTTTGTGTCTTGCCCCGGAAGACACTGAGTTCATTGTACATGTACACCCTCTGCGCCCTGCCCACCCTTGTAGCTGGTCTTTGTTTTCT

TACCTCCCCTTTCTGACCCATGTATATCATATTATGTGAGATACCATCTGCCTGAAAAAAGACCTTGTGCGGATTCTTGGGAACATTGTAGCTGTTTCTG

TGTTTTTTCTTACCTTGTAGTCTGGTTCTGAATTATGAGAGGAAAAAAAAAGTAATTATGATACATTGTAGTTTGTGTACGATATATGTTGATAACGTTT

TATTAAAGGGACATCTTTTTTCCGC
Translation
MFAKGKGSAVPSDGQAREK KLALYVYEYLLHVGAQKSAQTFLSE IRWEKNITLGEPPGFLHSWWC - UNI16630 - CVFWDLYCAAPERRDTCEH

SSEAKAFHDY - UNI1821 - - UNI15948 - SAAAAPSPVLGNIPPNDGMPGGPIPPGFFQ - UNI4218 - GPPGSQPSPHAQPPPHNPSSM

MGPHSQ PFMSPRYAGGPRPPIRMGNQ PPGGVPGTQPLLPNSMDPTRQQG - UNI18233 - GHPNMGGSMQRMNPPRGMGPMGPGPQ - UNI288

20 - NYGSGMRPPPNSLGPAMPGINM - UNI20588 - MGPGAGRPWPNPNSANS - UNI18495 - IPYSSSSPGTYV GPPGGGGPPGTPIMP

SPAD - UNI5595 - DSTNSSDNIYTMINPVPPGGSRSN FPMGPGSDGPMGGMGGMEPHHMNGSLG GSGDIDGLPK NSPNNISGISNPPGTPRDD

GELGGNFLHSFQNDN YSPSMTMSV

For any suggestions or comments, please send an email to unitrap@crg.es