Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000062012 (Zfp13)
Chromosomal location
Chr 17: 23712819 - 23736454 (-)
Description
zinc finger protein 13 Gene [Source:MGI Symbol;Acc:MGI:99159]
RefSeq_dna
NM_011747 
RefSeq_peptide
NP_035877.1 
UniGene
Mm.40326 
MGI
MGI:99159 
Uniprot/SWISSPROT
P10754 
Human Ortholog
ENSG00000122386 (ZNF205)
Omim not available
UniTrap UNI12968
Vector Insertion
Chr 17: 23722542 - 23736118
Public Clones (ggtc) D072B06 (ggtc) CMHD-GT_352B1-3 (cmhd) CMHD-GT_476G1-3 (cmhd) CMHD-GT_475G1-3 (cmhd)
PST6388-NL (escells) IST12487F1 (tigm) IST12395G6 (tigm) IST10382D10 (tigm)
IST14029E11 (tigm) IST10076A3BBF2 (tigm) IST14350F11 (tigm) IST14115F12 (tigm)
IST10884C11 (tigm) IST11411F11 (tigm) IST12805B1 (tigm) IST12660F1 (tigm)
IST14153G1 (tigm) IST10265H3 (tigm) IST11025E7 (tigm) IST10392H2 (tigm)
IST13848C11 (tigm) IST13337B1 (tigm) IST13013C3 (tigm) IST13798D12 (tigm)
IST14636H8 (tigm) IST13578F10 (tigm) IST10090E10 (tigm) IST14457H8 (tigm)
IST15005B9 (tigm) IST14866E10 (tigm) IST13780A12 (tigm) IST14886A12 (tigm)
IST15043B12 (tigm) IST14274E9 (tigm) IST10068E12 (tigm) IST11788F5 (tigm)
Private Clones OST449974 (lexicon) OST437614 (lexicon) OST418959 (lexicon) OST416502 (lexicon)
OST345033 (lexicon) OST333742 (lexicon) OST319019 (lexicon) OST295672 (lexicon)
OST292513 (lexicon) OST286257 (lexicon) OST285883 (lexicon) OST282033 (lexicon)
OST281512 (lexicon) OST268856 (lexicon) OST261973 (lexicon) OST240409 (lexicon)
OST204064 (lexicon) OST148798 (lexicon) OST148627 (lexicon) OST147304 (lexicon)
OST132083 (lexicon) OST131024 (lexicon) OST107071 (lexicon) OST79587 (lexicon)
OST68218 (lexicon) OST67562 (lexicon) OST52851 (lexicon) OST41035 (lexicon)
OST36981 (lexicon) OST34139 (lexicon) OST30035 (lexicon)
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31127
Vector Insertion
Chr 17: 23712818 - 23717200
Public Clones IST14577H5 (tigm) IST12238B2 (tigm) IST11631D8 (tigm) IST15054F8 (tigm)
IST12836A10 (tigm) IST14936D5 (tigm) IST10689G9 (tigm) IST13544H3 (tigm)
IST10266B2 (tigm) IST14767H11 (tigm) IST13761H9 (tigm) IST10902H4 (tigm)
IST13034A3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 31% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000057029
Sequence
GATGTCTCAGACTGTCGTGACTAGGCCCAGCCTTGCTCTGGCTGCTCCTAAGTTTCCCTGCTAGGGTCAGCATCCAGCTTATTTTTAACTGTGTGGGGTG

GATCTCACTGGACCACCCAGTAGGCACCAGTTTTCTTACTGCGCTCTATGTCCTCAGCACAGAGCCCAACGCCTAGCACGCAGGACACAGGAAAAGGCTG

AGCGACAGCTTGACTTAGGCACCGCCCTCAAGAGATTTCCAGTTTTTCAATGGCAGAGCACCTCAACTTCCTGCTGCGGACTCCTCCCACAATCCTGCAA

CTTTGATTCCTCTCTAGAAGCCCCAACCCAAGAGAG - UNI12968 - GTTCTTGGCTAAAACCTGGACGGGGCTCGACTAGCAAGGGAAAGAACCAT

TTGCTGTTTTTCCTGGCTCTGAAGTGGAAGATGTCTGCAGACAGTCAAAGCATCGCGGCTACTGAGAACGAGGAGAAATCCCATGAG GTCCCAGGTAAT

GTGCAACACTGTGGAGACATGCTCTCTGGACAGGAGGAGACAGTGCCCTTGGGAACCTCTCAGGAGTCAACACACATCAAGGCAGAGCCAGAAGAGCCAC

ACAGTGAGGGGGCATCACGGGAGGACAGGACTCCAGGAACACAGCGCTGGATGTCCCCGTGTCCTGGCCCTAAGGACAAAG TTGTTCCTTCTCCCTGGA

CTCCTGTACTGTCCCGAGGGGGACGGACCAGAGAGCGAAAGATGGCTGCTGCACTCCTTACTGCCTGGTCCCAG - UNI31127 - ATGCCGGTGACC

TTTGAGGATGTGGCCCTGTATCTCTCCCAGGAGGAGTGGGGAAGGCTGGACCACACACAGCAAAATTTCTACAGAGATGTACTACAGGGGAAAAACGGGC

TGGCTTTGG - UNI31127 - GAGCCGTGGAAATGGGGAAGGTGGTTCCAGCCTTGGCCGTCGCAACCCTAGAGGACACAAAATCGATAAGGACTAGG

GCCAGGTGGGCCCCGGGGGAAGACCCAAAGTGTGGTCAGCACGTGGCTAGTGGCCCAGGTACAAAGCTGACCAGAGACACTGGGAAAGCTGGTCAGCTAA

AGCCAGCCCCATCTGAATCACGTCCTCTCAAGACCCCAGAGGACAGCGGCCCAGAGAAACCCAGTGAGGGGGAGGAGGCTCTGAAAAGTGGCGAAGAGGG

TCTGGTACCCGACGGTGACACGGGCAAGAAGACATACAAGTGCGAGCAGTGTGGCAAGGGCTTCAGTTGGCACTCGCACCTGGTGACACACCGGCGTACG

CACACGGGCGAGAAGCCTTATACCTGCACGGACTGTGGCAAGCGCTTCGGCCGCAGCTCACACCTCATCCAGCACCAGATCATCCACACGGGCGAGAAGC

CCTATACCTGCCCCTCGTGTTGGAAGAGCTTCAGCCACCACTCCACGCTGATCCAGCACCAGCGCATCCACACTGGTGAGAAGCCCTACGTGTGCGACCG

CTGTGCCAAGCGCTTCACCCGTCGCTCGGACCTAGTCACACACCAGGGCACTCACACCGGCGCCAAGCCCCACAAGTGCCCCATCTGCAGCAAGTGCTTC

ACCCAGAGCTCCGCCCTGGTCACGCACCAGCGCACCCACACCGGCGTCAAGCCCTACCCGTGCCCGGAGTGCGGCAAGTGCTTCAGCCAGCGCTCCAATC

TCATCGCACATAATCGCACCCACACGGGCGAGAAGCCCTACCACTGCCTCGACTGTGGCAAGAGCTTCAGCCACAGCTCGCACCTCACTGCCCACCAACG

CACTCACCGTGGCGTGAGGCCCTACTCCTGCCCACTTTGCGGCAAGAGCTTCAGCCGCCGCTCCAACCTGCACCGGCACGAGAAGATCCACACCACTGGA

CCCAAGGCTCTGGCCATGCTCATGCTGGGGGCGGCAGCTGCGGGGGCGCTCACGGCACCACCACCTGCTTCCACTTAGAAGCCTGAGAGAGAGCAGTGAG

AACACCCAGGGAAGCTGGGACAACCCCGCTGATGCTAGGGCCCTGGGAAGACGCTGGGTCTTAGCCAGTGGGATGATGGAGTGGGGTGAGGACTGGGAGG

TGGCACAGGTGGGCATGGTAACGTGGGAGGAGCCAGGGCTAGAAGGGCAGGCACTCTAGCTGCAGATTAAAGGCCTGGATTTC
Translation
 - UNI12968 - MSADSQSIAATENEEKSHE VPGNVQHCGDMLSGQEETVPLGTSQESTHIKAEPEEPHSEGASREDRTPGTQRWMSPCPGPKDKV 

VVPSPWTPVLSRGGRTRERKMAAALLTAWSQ - UNI31127 - MPVTFEDVALYLSQEEWGRLDHTQQNFYRDVLQGKNGLALG - UNI31127 - 

GAVEMGKVVPALAVATLEDTKSIRTRARWAPGEDPKCGQHVASGPGTKLTRDTGKAGQLKPAPSESRPLKTPEDSGPEKPSEGEEALKSGEEGLVPDGDT

GKKTYKCEQCGKGFSWHSHLVTHRRTHTGEKPYTCTDCGKRFGRSSHLIQHQIIHTGEKPYTCPSCWKSFSHHSTLIQHQRIHTGEKPYVCDRCAKRFTR

RSDLVTHQGTHTGAKPHKCPICSKCFTQSSALVTHQRTHTGVKPYPCPECGKCFSQRSNLIAHNRTHTGEKPYHCLDCGKSFSHSSHLTAHQRTHRGVRP

YSCPLCGKSFSRRSNLHRHEKIHTTGPKALAMLMLGAAAAGALTAPPPAST
Transcript ENSMUST00000115516
Sequence
GATGTCTCAGACTGTCGTGACTAGGCCCAGCCTTGCTCTGGCTGCTCCTAAGTTTCCCTGCTAGGGTCAGCATCCAGCTTATTTTTAACTGTGTGGGGTG

GATCTCACTGGACCACCCAGTAGGCACCAGTTTTCTTACTGCGCTCTATGTCCTCAGCACAGAGCCCAACGCCTAGCACGCAGGACACAGGAAAAGGCTG

AGCGACAGCTTGACTTAGGCACCGCCCTCAAGAGATTTCCAGTTTTTCAATGGCAGAGCACCTCAACTTCCTGCTGCGGACTCCTCCCACAATCCTGCAA

CTTTGATTCCTCTCTAGAAGCCCCAACCCAAGAGAG - UNI12968 - GTTCTTGGCTAAAACCTGGACGGGGCTCGACTAGCAAGGGAAAGAACCAT

TTGCTGTTTTTCCTGGCTCTGAAGTGGAAGATGTCTGCAGACAGTCAAAGCATCGCGGCTACTGAGAACGAGGAGAAATCCCATGAG GTCCCAGGTAAT

GTGCAACACTGTGGAGACATGCTCTCTGGACAGGAGGAGACAGTGCCCTTGGGAACCTCTCAGGAGTCAACACACATCAAGGCAGAGCCAGAAGAGCCAC

ACAGTGAGGGGGCATCACGGGAGGACAGGACTCCAGGAACACAGCGCTGGATGTCCCCGTGTCCTGGCCCTAAGGACAAAGGTCCGTTCCTGCCTGGTGG

AG TTGTTCCTTCTCCCTGGACTCCTGTACTGTCCCGAGGGGGACGGACCAGAGAGCGAAAGATGGCTGCTGCACTCCTTACTGCCTGGTCCCAG - UN

I31127 - ATGCCGGTGACCTTTGAGGATGTGGCCCTGTATCTCTCCCAGGAGGAGTGGGGAAGGCTGGACCACACACAGCAAAATTTCTACAGAGATG

TACTACAGGGGAAAAACGGGCTGGCTTTGG - UNI31127 - GAGCCGTGGAAATGGGGAAGGTGGTTCCAGCCTTGGCCGTCGCAACCCTAGAGGAC

ACAAAATCGATAAGGACTAGGGCCAGGTGGGCCCCGGGGGAAGACCCAAAGTGTGGTCAGCACGTGGCTAGTGGCCCAGGTACAAAGCTGACCAGAGACA

CTGGGAAAGCTGGTCAGCTAAAGCCAGCCCCATCTGAATCACGTCCTCTCAAGACCCCAGAGGACAGCGGCCCAGAGAAACCCAGTGAGGGGGAGGAGGC

TCTGAAAAGTGGCGAAGAGGGTCTGGTACCCGACGGTGACACGGGCAAGAAGACATACAAGTGCGAGCAGTGTGGCAAGGGCTTCAGTTGGCACTCGCAC

CTGGTGACACACCGGCGTACGCACACGGGCGAGAAGCCTTATACCTGCACGGACTGTGGCAAGCGCTTCGGCCGCAGCTCACACCTCATCCAGCACCAGA

TCATCCACACGGGCGAGAAGCCCTATACCTGCCCCTCGTGTTGGAAGAGCTTCAGCCACCACTCCACGCTGATCCAGCACCAGCGCATCCACACTGGTGA

GAAGCCCTACGTGTGCGACCGCTGTGCCAAGCGCTTCACCCGTCGCTCGGACCTAGTCACACACCAGGGCACTCACACCGGCGCCAAGCCCCACAAGTGC

CCCATCTGCAGCAAGTGCTTCACCCAGAGCTCCGCCCTGGTCACGCACCAGCGCACCCACACCGGCGTCAAGCCCTACCCGTGCCCGGAGTGCGGCAAGT

GCTTCAGCCAGCGCTCCAATCTCATCGCACATAATCGCACCCACACGGGCGAGAAGCCCTACCACTGCCTCGACTGTGGCAAGAGCTTCAGCCACAGCTC

GCACCTCACTGCCCACCAACGCACTCACCGTGGCGTGAGGCCCTACTCCTGCCCACTTTGCGGCAAGAGCTTCAGCCGCCGCTCCAACCTGCACCGGCAC

GAGAAGATCCACACCACTGGACCCAAGGCTCTGGCCATGCTCATGCTGGGGGCGGCAGCTGCGGGGGCGCTCACGGCACCACCACCTGCTTCCACTTAGA

AGCCTGAGAGAGAGCAGTGAGAACACCCAGGGAAGCTGGGACAACCCCGCTGATGCTAGGGCCCTGGGAAGACGCTGGGTCTTAGCCAGTGGGATGATGG

AGTGGGGTGAGGACTGGGAGGTGGCACAGGTGGGCATGGTAACGTGGGAGGAGCCAGGGCTAGAAGGGCAGGCACTCTAGCTGCAGATTAAAGGCCTGGA

TTTC
Translation
 - UNI12968 - MSADSQSIAATENEEKSHE VPGNVQHCGDMLSGQEETVPLGTSQESTHIKAEPEEPHSEGASREDRTPGTQRWMSPCPGPKDKGP

FLPGGV VVPSPWTPVLSRGGRTRERKMAAALLTAWSQ - UNI31127 - MPVTFEDVALYLSQEEWGRLDHTQQNFYRDVLQGKNGLALG - UNI3

1127 - GAVEMGKVVPALAVATLEDTKSIRTRARWAPGEDPKCGQHVASGPGTKLTRDTGKAGQLKPAPSESRPLKTPEDSGPEKPSEGEEALKSGEEG

LVPDGDTGKKTYKCEQCGKGFSWHSHLVTHRRTHTGEKPYTCTDCGKRFGRSSHLIQHQIIHTGEKPYTCPSCWKSFSHHSTLIQHQRIHTGEKPYVCDR

CAKRFTRRSDLVTHQGTHTGAKPHKCPICSKCFTQSSALVTHQRTHTGVKPYPCPECGKCFSQRSNLIAHNRTHTGEKPYHCLDCGKSFSHSSHLTAHQR

THRGVRPYSCPLCGKSFSRRSNLHRHEKIHTTGPKALAMLMLGAAAAGALTAPPPAST

For any suggestions or comments, please send an email to unitrap@crg.es