Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000062031 (Athl1)
Chromosomal location
Chr 7: 148127480 - 148133557 (+)
Description
ATH1, acid trehalase-like 1 (yeast) Gene [Source:MGI Symbol;Acc:MGI:2444047]
RefSeq_dna
NM_145387 
RefSeq_peptide
NP_663362.2 
MGI
MGI:2444047 
Uniprot/SWISSPROT
Q8BP56 
Human Ortholog
ENSG00000142102 (ATHL1)
Omim not available
UniTrap UNI36871
Vector Insertion
Chr 7: 148127543 - 148128183
Public Clones IST10407D1 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 2% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI25351
Vector Insertion
Chr 7: 148129675 - 148130543
Public Clones not available
Private Clones OST187069 (lexicon)
Severity of mutation (?) Insertion after 68% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000093982
Sequence
GGCAGCTCGCACCCACAGAGCCTTCTTACACCCGGATCCCCGCACTGAGTGGAGAGGGCAGCG - UNI36871 - GCCGTCTGGGCTGAGGCAGCTTT

CCATGGACGGCTCTGAAGATGACCCGACCATATTCAGTGCCCGTTGTCTGCCCAGTGACCCCAGGCTCTGGGCCACTGTAACGAACTCATACCTAGGTAC

ACGTGTGTATCATGACACCATCCATATAAACGGTGTGTACAATGGAGCTGTCGGGGACACTCACCGGGCCAGTCTGCCCAGCCCCCTCAATGTCCAGCTG

GAGGCCCCTGCAGGGACAGAACAGCTGACAGAGACCTTTACCCTGGACACCAACACAG GTTCCTTCCTCCACACCCTGGAAGGCCCCAGCTTCCGGGCT

TCCCAGCGGATCTATGCTCACCGTGTGTTACCCCATGTCCTGGTCTTCAGTGTGTCCATTGCACGCTTGACCACAGGGAACAAACCCATCACAGTGCCGT

TACGGGCAGACTTCTCCCCCGAAAGCCCAGACCTGGACCTGCGTGTGGGGCCTGACTTCCAGGGACTCCG GTACCTGCATGGCCACGTACTTAACCCTG

AGCAGCCTGGAGAGCCACAGCAGGAAGTGCATATGCTATGGATGCCTGTCCCCCCAGCCTTGACCCTTGGGGAAGAGGAGAAGGACAGGACCTGGGAGTT

TCTGACTGTTGTGGGTAGCAGCCAGGCTGAAGCCCAGGACTGCTTTGCTGAGGCCCTACAGCTGCAGACCAGGGGTGTTCTGTATACAATCCATGCAGAC

TCCTGGGGCCGGCTCTGGGCAGGCTGTGGCCTGGATGTGGCTGGGCCCCTGGCCCTGCGCCAGGCCCTTCGTGGCTCTCTCTACTACCTGTTCAGTGAGC

TTCCCCAGCCTGGCACTCAAGGATTCATCAGCCATGGGCTTAGCCCCGGAGGACTCTCCAATGGGAGTAAGGAGGAATGCTACTGGGGCCATATCTTCTG

GGATCAGGTACATCCTACCCTGCACTGGTTACACAGGGGGAGTTGCATGCAAAGATTCCGGGCATTGCCT - UNI25351 - CACTTCGCTGCTGCTT

TGGCCAAGGACTTGGGTTTGCCTATCCGAAAACAGTGGCTGGAGGTGGCTGATAGGATCAAGATACCATTTGACTCTGAGCAGAACTTCCACCCTGAGTT

TGATGGCTATGAGCGTG GAGAAGAGGTGAAGCAGGCAGATGTTGTGCTCCTGGGGTACCCAGTCCCCTTTCCCCTGACACCTGACATCCGAAGGAAAAA

CTTGGAGACTTATGAGGCCGTGACATCCCCCCAGGGCCCTGCTATGACCTGG ACCTTTGACCCCCTGTGTCCAGACCTGGTCTCCAGAGTATCTGTCTC

TGGTATCTCCTACCTGGGGAACAAGATCAACTTCGCCTTTTCCAAGGACTCGGTGACACTTGAGGTCACAGCCCGTGCAGAGCCCTGGGCACCCCTACTA

GAAGCTGAGCTGTGGCCATCGCTGGCTCATCTTCCCCTGACACCAGGTAGGGAA
Translation
RTEWRGQR - UNI36871 - RPSGLRQLSMDGSEDDPTIFSARCLPSDPRLWATVTNSYLGTRVYHDTIHINGVYNGAVGDTHRASLPSPLNVQLEAP

AGTEQLTETFTLDTNTG GSFLHTLEGPSFRASQRIYAHRVLPHVLVFSVSIARLTTGNKPITVPLRADFSPESPDLDLRVGPDFQGLR RYLHGHVLNP

EQPGEPQQEVHMLWMPVPPALTLGEEEKDRTWEFLTVVGSSQAEAQDCFAEALQLQTRGVLYTIHADSWGRLWAGCGLDVAGPLALRQALRGSLYYLFSE

LPQPGTQGFISHGLSPGGLSNGSKEECYWGHIFWDQVHPTLHWLHRGSCMQRFRALP - UNI25351 - HFAAALAKDLGLPIRKQWLEVADRIKIPF

DSEQNFHPEFDGYERG GEEVKQADVVLLGYPVPFPLTPDIRRKNLETYEAVTSPQGPAMTW TFDPLCPDLVSRVSVSGISYLGNKINFAFSKDSVTLE

VTARAEPWAPLLEAELWPSLAHLPLTPGRE
Transcript ENSMUST00000079403
Sequence
GGCAGCTCGCACCCACAGAGCCTTCTTACACCCGGATCCCCGCACTGAGTGGAGAGGGCAGCG - UNI36871 - GCCGTCTGGGCTGAGGCAGCTTT

CCATGGACGGCTCTGAAGATGACCCGACCATATTCAGTGCCCGTTGTCTGCCCAGTGACCCCAGGCTCTGGGCCACTGTAACGAACTCATACCTAGGTAC

ACGTGTGTATCATGACACCATCCATATAAACGGTGTGTACAATGGAGCTGTCGGGGACACTCACCGGGCCAGTCTGCCCAGCCCCCTCAATGTCCAGCTG

GAGGCCCCTGCAGGGACAGAACAGCTGACAGAGACCTTTACCCTGGACACCAACACAG GTTCCTTCCTCCACACCCTGGAAGGCCCCAGCTTCCGGGCT

TCCCAGCGGATCTATGCTCACCGTGTGTTACCCCATGTCCTGGTCTTCAGTGTGTCCATTGCACGCTTGACCACAGGGAACAAACCCATCACAGTGCCGT

TACGGGCAGACTTCTCCCCCGAAAGCCCAGACCTGGACCTGCGTGTGGGGCCTGACTTCCAGGGACTCCG GTACCTGCATGGCCACGTACTTAACCCTG

AGCAGCCTGGAGAGCCACAGCAGGAAGTGCATATGCTATGGATGCCTGTCCCCCCAGCCTTGACCCTTGGGGAAGAGGAGAAGGACAGGACCTGGGAGTT

TCTGACTGTTGTGGGTAGCAGCCAGGCTGAAGCCCAGGACTGCTTTGCTGAGGCCCTACAGCTGCAGACCAGGGGTGTTCTGTATACAATCCATGCAGAC

TCCTGGGGCCGGCTCTGGGCAGGCTGTGGCCTGGATGTGGCTGGGCCCCTGGCCCTGCGCCAGGCCCTTCGTGGCTCTCTCTACTACCTGTTCAGTGAGC

TTCCCCAGCCTGGCACTCAAGGATTCATCAGCCATGGGCTTAGCCCCGGAGGACTCTCCAATGGGAGTAAGGAGGAATGCTACTGGGGCCATATCTTCTG

GGATCAG - UNI25351 - GACATCTGGATGTTCCCAAATATTTTGATGTTCCACCCAGAAGCCGCCAGGGCCATCCTAGAATACCGAGTCCGTACGC

TGGGAGGAGCCCTGAAGAATGGCCAGAACCTGGGCTACCAG GGAGCCAAGTTTGCTTGGGAGAGTGCAAGCACTGGCCTGGAGGTCTGCCCTGAGGACA

TTTATGGGACCCAGGAGATCCATATCAATGGGGCTGTGGCCTTGGCCTTTCAGCTGTATTACTATTACACTCAG GACTCGAAGCTCTTCCAAGAGGATG

GTGGCTGGGATGTGGTCAGTTCTGTGGCTGAGTTTTGGTGTAGCCGTGTAGAATGGAGCTCCCAGGACAAGATGTACCACCTGAAAG GAGTCATGCCCC

CCGATGAGTACCATTCAGGAGTCAACAACTCTGTCTACACCAATGTCCTGGTCCAGAACAG CCTGCACTTCGCTGCTGCTTTGGCCAAGGACTTGGGTT

TGCCTATCCGAAAACAGTGGCTGGAGGTGGCTGATAGGATCAAGATACCATTTGACTCTGAGCAGAACTTCCACCCTGAGTTTGATGGCTATGAGCGTG 

GAGAAGAGGTGAAGCAGGCAGATGTTGTGCTCCTGGGGTACCCAGTCCCCTTTCCCCTGACACCTGACATCCGAAGGAAAAACTTGGAGACTTATGAGGC

CGTGACATCCCCCCAGGGCCCTGCTATGACCTGG AGCATGTTTGCTGTGGGCTGGATGGAACTGAGGGACCCCTCAAGGGCTCAGGTCCACCTGAGCAG

GAGTTTCGCCAATGTCACTGAGCCCTTCAAG GTGTGGACGGAGAATGCAGACGGGTCTGGTGCAGTGAACTTCTTGACTGGCATGGGGGGCTTCCTGCA

GGCAGCACTCTTCGGGTGCACAGGATTCAG GATCACTGAGGCAGGTGTGACCTTTGACCCCCTGTGTCCAGACCTGGTCTCCAGAGTATCTGTCTCTGG

TATCTCCTACCTGGGGAACAAGATCAACTTCGCCTTTTCCAAGGACTCGGTGACACTTGAGGTCACAGCCCGTGCAGAGCCCTGGGCACCCCTACTAGAA

GCTGAGCTGTGGCCATCGCTGGCTCATCTTCCCCTGACACCAG GACAGAAGGTCTCCTTTCCCCACTCAGCTGGCCGGATACAAAGGTCATCCCCATAG

CTGCCCAGAAATTCTTCCGTGGTTCCTGATAGGAGTTTTGGCATTAGAAGTCCCTTTCAGTTCCTCTGGGACACTCTTTTGCCCTCAACTGCATCCCCAA

CCTCACAACCTCTTAGTCTGGATCCAGCCCTGAAGCAGTAAGGTTACAGGGTGTCCCTTCTGTCCCTTCTGTCCCCTCCCTCCTTTCCTCACCCTCGCCA

GTCCTGGGCTCTCTAGGCCTCACAGATCCTTTGTTTGGGGCTGACCGCAGCACCCTCCCCTCCTTATCTCCCCACCTTCCTGTCTCTCTAGGCCTTAACT

TCCTGTTCACACGTCTGTTCTCTGGGAAACTCTGGTCAGCAGGCTAGGTGGGAAGTGGCCAGTGACTCCGCTGAGAAGTGAGTCACAGTCAGGGGCTTAG

CTACAGGAGTTTCTTGTGGCAGGCAGTTGACACCAGGTAGGGCTAGCCAAGTGCTCAGAGGTTTTGCGGCTTTGAACTTCCTAGTCTTTGATTCCTTTCT

GACGTCAGATGGTATCTAGCGTACTGGGCTAAGGTGAGAGCTGTCCTTAACCACTCAGCCCGTGAGAAGGAAGGCAGTGTTATCACAGGACAGGGTAAAT

GAAGTCAGACTGGCGACCAGAGGGAATGGAGTCAGATGGACAGGGTTCCAGGCCATGGTCCTGGCCATCAGTGCTGAGCAGCAGCGTGGCCTTCACTTCC

ATTCTTAGTGTTTCTCCAGAACAAGGTTCATAGCGTAGGACCACGATCCTGGTAAACCCTGTGCTCCTGTACCAAGCCAACTTGGCTAATTAAAGTCAGT

GCTGGCAAAGGCTG
Translation
 - UNI36871 - MDGSEDDPTIFSARCLPSDPRLWATVTNSYLGTRVYHDTIHINGVYNGAVGDTHRASLPSPLNVQLEAPAGTEQLTETFTLDTNTG

 GSFLHTLEGPSFRASQRIYAHRVLPHVLVFSVSIARLTTGNKPITVPLRADFSPESPDLDLRVGPDFQGLR RYLHGHVLNPEQPGEPQQEVHMLWMPV

PPALTLGEEEKDRTWEFLTVVGSSQAEAQDCFAEALQLQTRGVLYTIHADSWGRLWAGCGLDVAGPLALRQALRGSLYYLFSELPQPGTQGFISHGLSPG

GLSNGSKEECYWGHIFWDQ - UNI25351 - DIWMFPNILMFHPEAARAILEYRVRTLGGALKNGQNLGYQ GAKFAWESASTGLEVCPEDIYGTQEI

HINGAVALAFQLYYYYTQ DSKLFQEDGGWDVVSSVAEFWCSRVEWSSQDKMYHLKG GVMPPDEYHSGVNNSVYTNVLVQNS SLHFAAALAKDLGLPI

RKQWLEVADRIKIPFDSEQNFHPEFDGYERG GEEVKQADVVLLGYPVPFPLTPDIRRKNLETYEAVTSPQGPAMTW SMFAVGWMELRDPSRAQVHLSR

SFANVTEPFK VWTENADGSGAVNFLTGMGGFLQAALFGCTGFR RITEAGVTFDPLCPDLVSRVSVSGISYLGNKINFAFSKDSVTLEVTARAEPWAPL

LEAELWPSLAHLPLTPG GQKVSFPHSAGRIQRSSP

For any suggestions or comments, please send an email to unitrap@crg.es