Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000062044 (Lmtk3)
Chromosomal location
Chr 7: 53039108 - 53059514 (+)
Description
lemur tyrosine kinase 3 Gene [Source:MGI (curated);Acc:Lmtk3-001]
RefSeq_dna
NM_001005511 
RefSeq_peptide
NP_001005511.2 
UniGene
Mm.44928 
MGI
MGI:3039582 
Uniprot/SWISSPROT
Q5XJV6 
Uniprot/SPTREMBL
A6BLZ0 
Human Ortholog
ENSG00000142235 (LMTK3)
Omim not available
UniTrap UNI33469
Vector Insertion
Chr 7: 53053964 - 53055805
Public Clones IST12237D4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 93% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI35508
Vector Insertion
Chr 7: 53056420 - 53059001
Public Clones IST14153H3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000120005
Sequence
CCTCCGTCCGCCTCTCCATCCCTTCATCCGTCTGTCCTTTCGAGGAGGGGGAGGGGGGTATCAGAACCAGTAAGCAACCCCTCCCTCCCCCTGTCCTGCA

TCTCCCGCCCCTCTCCTGGGCTGAGGGAGGCCAGGGTTGAGCGGGTCCCCATGGCTGGGGGCTGAGGGCCCGCCCCCCCTCCTCCCCAGCCGCCGATTCC

TCCACCTCCCTTCCATCCTGGACAAGATGCCTGCACCCGGCGCACTCATCCTCCTGGCGGCCGTCTCCGCCTCCGGCTGCCTGGCGTCCCCAGCGCACCC

GG ATGGATTCGCTCTGAGCCGGGCCCCTTTGGCTCCGCCCTACGCTGTGGTCCTCATTTCCTGTTCGGGTCTGCTGGCCTTCATCTTTCTCCTCCTTAC

CTGTCTGTGTTGCAAACGGGGTGATGTTCGTTTCAAG GAGTTTGAGAACCCGGAAGGGGAGGACTGCTCTGGGGAGTACACCCCCCCTGCGGAGGAGAC

CTCCTCCTCACAGTCGCTGCCTGATGTCTATATTCTGCCGCTGGCAGAGGTCTCACTGCCAATGCCTGCCCCGCAGCCTCCACACTCAG ACATCAGCAC

CCCCCTGGGCCTGAGCCGCCAGCACCTCAGCTACCTGCAGGAGATTGGCAGCGGCTGGTTTGGGAAG GTGATCCTCGGGGAGGTTTTCTCAGACTACTC

GCCAGCCCAGGTGGTGGTGAAGGAACTCCGGGCTAGTGCCGGGCCCCTGGAACAGCGCAAGTTCATCTCCGAGGCTCAGCCCTACAG GAGCCTGCAGCA

TCCCAACGTCCTCCAGTGCCTGGGCGTCTGTGTGGAGACCTTGCCCTTCCTGTTGATCATGGAGTTCTGCCAGCTG GGGGACCTGAAGCGATACCTTCG

GGCCCAGCGGCCACCTGAAGGCATGTCCCCTGAACTTCCCCCTCGAGACCTTCGGACACTGCAGAGGATGGGTCTAGAGATTGCCCGAGGACTGGCACAC

CTGCACTCTCACAACTATGTGCACAG CGATCTGGCGCTGCGCAACTGCCTGCTAACTTCAGACCTGACTGTGCGTATTGGAGACTATGGGCTGGCGCAC

AGCAACTACAAG GAAGACTACTACCTGACACCCGAGCGCCTATGGGTGCCGCTGCGCTGGGCAGCGCCCGAGCTGCTGGGCGAGCTGCACGGCAGCTTC

GTGCTGGTAGATCAAAGCCGGGAGAGTAATGTCTG GTCCCTGGGGGTGACACTCTGGGAGCTATTCGAGTTCGGGGCACAGCCCTATCGTCACCTATCG

GATGAGGAGGTCCTGGCCTTTGTTGTCCGCCAGCAGCACGTGAAGCTGGCCCGGCCCAGGCTCAAGCTGCCCTACGCTGACTATTG GTATGACATTTTG

CAGTCTTGCTGGCGGCCGCCAGCCCAGCGCCCCTCAGCTTCTGATCTCCAGCTGCAGCTCACTTACCTGCTGTCTGAGCGGCCCCCCAGGCCCCCTCCTC

CACCACCCCCTCCCCGAGATGGGCCCTTCCCCTGGCCCTGGCCCCCCTCGCATAGTGCGCCGCGCCCAGGGACCCTGTCCTCCCAGTTCCCCCTTCTGGA

TGGCTTCCCCGGGGCTGACCCTGATGATGTACTCACAGTCACCGAGAGCAGCCGTGGCCTCAACCTTGAGTGCCTGTGGGAGAAGGCCCGCCGTGGGGCA

GGCCGGGGTGGGGGTGCACCTCCCTGGCAACCCGCTTCTGCGCCTCCTGCGCCCCATACCAATCCATCCAATCCCTTCTATGAGGCGCTGTCCACCCCTA

GCGTGCTTCCGGTCATCAGCGCACGCAGTCCCTCGGTGAGCAGCGAGTACTATATCCGCCTGGAGGAGCACGGTTCTCCACCAGAGCCCCTCTTCCCCAA

CGACTGGGACCCGCTGGACCCAGGAGTACCCGGTCCCCAGGCCCCCCAGACTCCCTCCGAGGTCCCTCAGCTGGTGTCCGAGACCTGGGCTTCCCCCCTC

TTCCCCGCGCCCCGACCCTTCCCGGCCCAGTCCTCGGGATCAGGTGGTTTCCTGCTGAGCGGCTGGGACCCCGAGGGCCGGGGCGCAGGAGAGACCCTGG

CAGGAGATCCTGCCGAGGTGCTTGGGGAACAGGGTACCGCACCCTGGGCCGAAGAGGAGGAGGAAGAGAGCTCCCCAGGCGAGGACAGCAGCAGCCTTGG

AGGGGGACCCAGCCGCAGGGGACCCCTCCCCTGTCCCTTGTGCAGCCGCGAGGGTCCCTGCTCCTGTCTGCCATTGGAGCGGGGGGACGCTGTGGCCGGC

TGGGGGGACCACCCTGCCCTTGGTTGTCCCCACCCCCCAGAGGACGACTCTTCCTTGCGTGCAGAGCGGGGCTCCTTGGCCGACCTGCCTCTGGTCCCCC

CTACCTCAGCCCCTCTCGAGTTTCTGGACCCCCTTATGGGGGCCGCAGCGCCCCAGTACCCCGGGCGGGGGCCACCTCCCGCTCCCCCCCCTCCACCGCC

CCCTCCCCGGGCCTCCGCGGAACCGGCCGCGTCCCCCGACCCCCCGTCGGCCCTGGCCAGTCCAGGCTCCGGCCTATCGTCTCCGGGCCCCAAGCCGGGG

GACAGCGGCTACGAGACCGAGACCCCTTTTTCCCCCGAGGGAGCCTTCCCAGGTGGGGGGGCGGCCGAGGAGGAAGGGGTCCCTCGGCCACGGGCTCCCC

CCGAGCCACCCGACCCAGGAGCGCCCCGGCCACCCCCAGACCCGGGTCCCCTCCCACTCCCAGGGTCCCAGGAGAAGCCAACCTTTGTAGTTCAGGTGAG

CACCGAGCAGCTGCTGATGTCCCTACGGGAGGATGTGACAAAGAACCTCCTAGGGGACAAGGGGTCGACACCCGGGGAGACAGGACCCAGGAAGGCGGGG

AGAAGCCCCGCGAACAGAGAGAAGGGCCCAGGCCCGAACAGGGACCTGACATCCCTGGTCAGCAGGAAGAAAGTCCCCAGCAGGAGCCTTCCAGTGAACG

GGGTGACAGTGTTGGAGAACGGGAAGCCAGGAGTCCCGGACATGAAGGAGAAGGTGGCGGAGAATGGCCTGGAATCTCCGGAGAAAGAAGAGAGAGCCCT

GGTGAATGGGGAGCCGATGTCCCCAGAGGCCGGGGAGAAGGTGCTGGCGAATGGGGTTCTGATGTCCCCAAAGAGCGAGGAGAAGGTGGCAGAGAATGGG

GTCCTGAGGCTGCCCAGGAACACGGAGAGGCCACCAGAGATTGGACCTCGGAGAGTCCCAGGGCCCTGGGAGAAGACGCCCGAGACTGGGGGTCTAGCTC

CCGAGACCCTGCTGGATCGAGCCCCTGCGCCCTGCGAGGCAGCCTTGCCCCAGAACGGCTTGGAGATGGCCCCTGGCCAGCTTGGCCCAGCCCCCAAGAG

CGGGAACCCAGACCCCGGGACCGAGTGGAGAGTCCACGAGAGTGGGGGGGCACCGAGAGCCCCCGGGGCTGGGAAGCTGGACCTCGGGAGTGGGGGCCGA

GCCCTGGGGGGCGTGGGGACGGCCCCCGCCGGCGGCCCCGCAAGCGCCGTGGACGCAAAGGCCGGATGGGTAGACAACTCGAGACCACTGCCACCTCCGC

CACAGCCACTGGGGGCCCAACAGAGGAGGCCGGAGCCAGTGCCCCTGAAAGCCAGGCCGGAGGTGGCCCAAGAGGAAGAGCCAGGGGTCCCAGACAACAG

GCTCGGCGGAGACATGGCCCCCAGCGTAGACGAGGACCCCCTCAAGCCGGAGAGGAAGGGCCCCGAGATGCCACGCTTGTTCCTGGACTTGGGACCACCT

CAGGGGAACAGCGAGCAGATCAAAG CCAAACTCTCCCGGCTCTCGCTGGCGCTCCCACCGCTCACGCTCACGCCGTTCCCGGGCCCGGGCCCGCGGCGG

CCACCTTGGGAGGGCGCGGACGCAGGGGCAGCTGGCGGGGAGGCCGGCGGGGCGGGGGCGCCGGGGCCAGCGGAGGAGGACGGGGAGGACGAGGACGAGG

ACGAGGAGGACGAGGAGGCAGCGGGCTCTCGGGATCCCGGGAGGACGCGGGAAGCCCCAGTGCCCGTCGTGGTGAGCAGCGCCGACGGGGACACGGTCCG

CCCGCTGCGGGGGCTGCTCAAGTCTCCACGCGCGGCCGACGAGCCAGAGGACAGCGAGCTGGAGAGGAAGCGCAAGATGGTCTCCTTCCACGGGGACGTG

ACCGTCTACCTCTTCGACCAG - UNI33469 - GAGACTCCAACCAACGAGTTGAGCGTCCAGGGCACCCCCGAGGGGGACACGGAGCCATCAACTCC

CCCAGCGCCCCCGACGCCTCCCCACCCCACCACCCCAGGAGATGGGTTTCCCAACAGCGACAGCGGCTTTG GCGGCAGTTTCGAGTGGGCGGAGGATTT

CCCCCTCCTCCCCCCGCCAGGCCCCCCCCTGTGCTTCTCCCGCTTCTCCGTCTCACCTGCACTGGAGACCCCGGGGCCTCCCGCCCGGGCTCCCGACGCC

CGGCCCGCAG - UNI35508 - GCCCCGTGGAGAACTGACTCCCCAAAGACCCAGCCCCTTTGCATCCCAAGAAGAGGGCTTGCGAGCAGAATCTTGT

GTGGACGATGGAGCCATTGCCCCTGACACTGACACAGCCTCTGGGGAGGTGCCTGAGGCTGGGCCCTCCCTCTCCTCCACCATGTGCCAAACAGGAGGCC

CAGGCCCTCCACCCAGCCCCCCAGATGAGTCCCCTGATCCCCCTGACCCCCCCGACCCCCTTGGAGCCACATGAGGCAGGAAGCCCCATCGCTGGACAGC

CACACGTCTTGGAACTGAACTGAACCGAACTCTTTTGGGCCCAGAGCCCCCTGGCACAGCAGAGGTCTCTCCTGGCCCCATGAGGGCCACTGGCTTCAGG

AACCTGGCCCCCCCCCCCCATCTTGCGTCTCCCCTTCCCCCAAGCCTGGCCCCTGGAGGGGGCCTCTGATTCAAACCTTCGCGTGACATTTTCACATTAT

TTAAAAAAAAAAGACAAAAACAACTTTTGGAGGAAAA
Translation
MPAPGALILLAAVSASGCLASPAHPD DGFALSRAPLAPPYAVVLISCSGLLAFIFLLLTCLCCKRGDVRFK EFENPEGEDCSGEYTPPAEETSSSQSL

PDVYILPLAEVSLPMPAPQPPHSD DISTPLGLSRQHLSYLQEIGSGWFGK VILGEVFSDYSPAQVVVKELRASAGPLEQRKFISEAQPYR RSLQHPN

VLQCLGVCVETLPFLLIMEFCQL GDLKRYLRAQRPPEGMSPELPPRDLRTLQRMGLEIARGLAHLHSHNYVHS SDLALRNCLLTSDLTVRIGDYGLAH

SNYK EDYYLTPERLWVPLRWAAPELLGELHGSFVLVDQSRESNVW WSLGVTLWELFEFGAQPYRHLSDEEVLAFVVRQQHVKLARPRLKLPYADYW W

YDILQSCWRPPAQRPSASDLQLQLTYLLSERPPRPPPPPPPPRDGPFPWPWPPSHSAPRPGTLSSQFPLLDGFPGADPDDVLTVTESSRGLNLECLWEKA

RRGAGRGGGAPPWQPASAPPAPHTNPSNPFYEALSTPSVLPVISARSPSVSSEYYIRLEEHGSPPEPLFPNDWDPLDPGVPGPQAPQTPSEVPQLVSETW

ASPLFPAPRPFPAQSSGSGGFLLSGWDPEGRGAGETLAGDPAEVLGEQGTAPWAEEEEEESSPGEDSSSLGGGPSRRGPLPCPLCSREGPCSCLPLERGD

AVAGWGDHPALGCPHPPEDDSSLRAERGSLADLPLVPPTSAPLEFLDPLMGAAAPQYPGRGPPPAPPPPPPPPRASAEPAASPDPPSALASPGSGLSSPG

PKPGDSGYETETPFSPEGAFPGGGAAEEEGVPRPRAPPEPPDPGAPRPPPDPGPLPLPGSQEKPTFVVQVSTEQLLMSLREDVTKNLLGDKGSTPGETGP

RKAGRSPANREKGPGPNRDLTSLVSRKKVPSRSLPVNGVTVLENGKPGVPDMKEKVAENGLESPEKEERALVNGEPMSPEAGEKVLANGVLMSPKSEEKV

AENGVLRLPRNTERPPEIGPRRVPGPWEKTPETGGLAPETLLDRAPAPCEAALPQNGLEMAPGQLGPAPKSGNPDPGTEWRVHESGGAPRAPGAGKLDLG

SGGRALGGVGTAPAGGPASAVDAKAGWVDNSRPLPPPPQPLGAQQRRPEPVPLKARPEVAQEEEPGVPDNRLGGDMAPSVDEDPLKPERKGPEMPRLFLD

LGPPQGNSEQIKA AKLSRLSLALPPLTLTPFPGPGPRRPPWEGADAGAAGGEAGGAGAPGPAEEDGEDEDEDEEDEEAAGSRDPGRTREAPVPVVVSSA

DGDTVRPLRGLLKSPRAADEPEDSELERKRKMVSFHGDVTVYLFDQ - UNI33469 - ETPTNELSVQGTPEGDTEPSTPPAPPTPPHPTTPGDGFPN

SDSGFG GGSFEWAEDFPLLPPPGPPLCFSRFSVSPALETPGPPARAPDARPAG - UNI35508 - GPVEN
Transcript ENSMUST00000072580
Sequence
CATCCTCGCCGAGGGCGGCAGTCCGCGCTTCCGG CCGCCGATTCCTCCACCTCCCTTCCATCCTGGACAAGATGCCTGCACCCGGCGCACTCATCCTCC

TGGCGGCCGTCTCCGCCTCCGGCTGCCTGGCGTCCCCAGCGCACCCGG ATGGATTCGCTCTGAGCCGGGCCCCTTTGGCTCCGCCCTACGCTGTGGTCC

TCATTTCCTGTTCGGGTCTGCTGGCCTTCATCTTTCTCCTCCTTACCTGTCTGTGTTGCAAACGGGGTGATGTTCGTTTCAAG GAGTTTGAGAACCCGG

AAGGGGAGGACTGCTCTGGGGAGTACACCCCCCCTGCGGAGGAGACCTCCTCCTCACAGTCGCTGCCTGATGTCTATATTCTGCCGCTGGCAGAGGTCTC

ACTGCCAATGCCTGCCCCGCAGCCTCCACACTCAG ACATCAGCACCCCCCTGGGCCTGAGCCGCCAGCACCTCAGCTACCTGCAGGAGATTGGCAGCGG

CTGGTTTGGGAAG GTGATCCTCGGGGAGGTTTTCTCAGACTACTCGCCAGCCCAGGTGGTGGTGAAGGAACTCCGGGCTAGTGCCGGGCCCCTGGAACA

GCGCAAGTTCATCTCCGAGGCTCAGCCCTACAG GAGCCTGCAGCATCCCAACGTCCTCCAGTGCCTGGGCGTCTGTGTGGAGACCTTGCCCTTCCTGTT

GATCATGGAGTTCTGCCAGCTG GGGGACCTGAAGCGATACCTTCGGGCCCAGCGGCCACCTGAAGGCATGTCCCCTGAACTTCCCCCTCGAGACCTTCG

GACACTGCAGAGGATGGGTCTAGAGATTGCCCGAGGACTGGCACACCTGCACTCTCACAACTATGTGCACAG CGATCTGGCGCTGCGCAACTGCCTGCT

AACTTCAGACCTGACTGTGCGTATTGGAGACTATGGGCTGGCGCACAGCAACTACAAG GAAGACTACTACCTGACACCCGAGCGCCTATGGGTGCCGCT

GCGCTGGGCAGCGCCCGAGCTGCTGGGCGAGCTGCACGGCAGCTTCGTGCTGGTAGATCAAAGCCGGGAGAGTAATGTCTG GTCCCTGGGGGTGACACT

CTGGGAGCTATTCGAGTTCGGGGCACAGCCCTATCGTCACCTATCGGATGAGGAGGTCCTGGCCTTTGTTGTCCGCCAGCAGCACGTGAAGCTGGCCCGG

CCCAGGCTCAAGCTGCCCTACGCTGACTATTG GTATGACATTTTGCAGTCTTGCTGGCGGCCGCCAGCCCAGCGCCCCTCAGCTTCTGATCTCCAGCTG

CAGCTCACTTACCTGCTGTCTGAGCGGCCCCCCAGGCCCCCTCCTCCACCACCCCCTCCCCGAGATGGGCCCTTCCCCTGGCCCTGGCCCCCCTCGCATA

GTGCGCCGCGCCCAGGGACCCTGTCCTCCCAGTTCCCCCTTCTGGATGGCTTCCCCGGGGCTGACCCTGATGATGTACTCACAGTCACCGAGAGCAGCCG

TGGCCTCAACCTTGAGTGCCTGTGGGAGAAGGCCCGCCGTGGGGCAGGCCGGGGTGGGGGTGCACCTCCCTGGCAACCCGCTTCTGCGCCTCCTGCGCCC

CATACCAATCCATCCAATCCCTTCTATGAGGCGCTGTCCACCCCTAGCGTGCTTCCGGTCATCAGCGCACGCAGTCCCTCGGTGAGCAGCGAGTACTATA

TCCGCCTGGAGGAGCACGGTTCTCCACCAGAGCCCCTCTTCCCCAACGACTGGGACCCGCTGGACCCAGGAGTACCCGGTCCCCAGGCCCCCCAGACTCC

CTCCGAGGTCCCTCAGCTGGTGTCCGAGACCTGGGCTTCCCCCCTCTTCCCCGCGCCCCGACCCTTCCCGGCCCAGTCCTCGGGATCAGGTGGTTTCCTG

CTGAGCGGCTGGGACCCCGAGGGCCGGGGCGCAGGAGAGACCCTGGCAGGAGATCCTGCCGAGGTGCTTGGGGAACAGGGTACCGCACCCTGGGCCGAAG

AGGAGGAGGAAGAGAGCTCCCCAGGCGAGGACAGCAGCAGCCTTGGAGGGGGACCCAGCCGCAGGGGACCCCTCCCCTGTCCCTTGTGCAGCCGCGAGGG

TCCCTGCTCCTGTCTGCCATTGGAGCGGGGGGACGCTGTGGCCGGCTGGGGGGACCACCCTGCCCTTGGTTGTCCCCACCCCCCAGAGGACGACTCTTCC

TTGCGTGCAGAGCGGGGCTCCTTGGCCGACCTGCCTCTGGTCCCCCCTACCTCAGCCCCTCTCGAGTTTCTGGACCCCCTTATGGGGGCCGCAGCGCCCC

AGTACCCCGGGCGGGGGCCACCTCCCGCTCCCCCCCCTCCACCGCCCCCTCCCCGGGCCTCCGCGGAACCGGCCGCGTCCCCCGACCCCCCGTCGGCCCT

GGCCAGTCCAGGCTCCGGCCTATCGTCTCCGGGCCCCAAGCCGGGGGACAGCGGCTACGAGACCGAGACCCCTTTTTCCCCCGAGGGAGCCTTCCCAGGT

GGGGGGGCGGCCGAGGAGGAAGGGGTCCCTCGGCCACGGGCTCCCCCCGAGCCACCCGACCCAGGAGCGCCCCGGCCACCCCCAGACCCGGGTCCCCTCC

CACTCCCAGGGTCCCAGGAGAAGCCAACCTTTGTAGTTCAGGTGAGCACCGAGCAGCTGCTGATGTCCCTACGGGAGGATGTGACAAAGAACCTCCTAGG

GGACAAGGGGTCGACACCCGGGGAGACAGGACCCAGGAAGGCGGGGAGAAGCCCCGCGAACAGAGAGAAGGGCCCAGGCCCGAACAGGGACCTGACATCC

CTGGTCAGCAGGAAGAAAGTCCCCAGCAGGAGCCTTCCAGTGAACGGGGTGACAGTGTTGGAGAACGGGAAGCCAGGAGTCCCGGACATGAAGGAGAAGG

TGGCGGAGAATGGCCTGGAATCTCCGGAGAAAGAAGAGAGAGCCCTGGTGAATGGGGAGCCGATGTCCCCAGAGGCCGGGGAGAAGGTGCTGGCGAATGG

GGTTCTGATGTCCCCAAAGAGCGAGGAGAAGGTGGCAGAGAATGGGGTCCTGAGGCTGCCCAGGAACACGGAGAGGCCACCAGAGATTGGACCTCGGAGA

GTCCCAGGGCCCTGGGAGAAGACGCCCGAGACTGGGGGTCTAGCTCCCGAGACCCTGCTGGATCGAGCCCCTGCGCCCTGCGAGGCAGCCTTGCCCCAGA

ACGGCTTGGAGATGGCCCCTGGCCAGCTTGGCCCAGCCCCCAAGAGCGGGAACCCAGACCCCGGGACCGAGTGGAGAGTCCACGAGAGTGGGGGGGCACC

GAGAGCCCCCGGGGCTGGGAAGCTGGACCTCGGGAGTGGGGGCCGAGCCCTGGGGGGCGTGGGGACGGCCCCCGCCGGCGGCCCCGCAAGCGCCGTGGAC

GCAAAGGCCGGATGGGTAGACAACTCGAGACCACTGCCACCTCCGCCACAGCCACTGGGGGCCCAACAGAGGAGGCCGGAGCCAGTGCCCCTGAAAGCCA

GGCCGGAGGTGGCCCAAGAGGAAGAGCCAGGGGTCCCAGACAACAGGCTCGGCGGAGACATGGCCCCCAGCGTAGACGAGGACCCCCTCAAGCCGGAGAG

GAAGGGCCCCGAGATGCCACGCTTGTTCCTGGACTTGGGACCACCTCAGGGGAACAGCGAGCAGATCAAAG CCAAACTCTCCCGGCTCTCGCTGGCGCT

CCCACCGCTCACGCTCACGCCGTTCCCGGGCCCGGGCCCGCGGCGGCCACCTTGGGAGGGCGCGGACGCAGGGGCAGCTGGCGGGGAGGCCGGCGGGGCG

GGGGCGCCGGGGCCAGCGGAGGAGGACGGGGAGGACGAGGACGAGGACGAGGAGGACGAGGAGGCAGCGGGCTCTCGGGATCCCGGGAGGACGCGGGAAG

CCCCAGTGCCCGTCGTGGTGAGCAGCGCCGACGGGGACACGGTCCGCCCGCTGCGGGGGCTGCTCAAGTCTCCACGCGCGGCCGACGAGCCAGAGGACAG

CGAGCTGGAGAGGAAGCGCAAGATGGTCTCCTTCCACGGGGACGTGACCGTCTACCTCTTCGACCAG - UNI33469 - GAGACTCCAACCAACGAGT

TGAGCGTCCAGGGCACCCCCGAGGGGGACACGGAGCCATCAACTCCCCCAGCGCCCCCGACGCCTCCCCACCCCACCACCCCAGGAGATGGGTTTCCCAA

CAGCGACAGCGGCTTTG GCGGCAGTTTCGAGTGGGCGGAGGATTTCCCCCTCCTCCCCCCGCCAGGCCCCCCCCTGTGCTTCTCCCGCTTCTCCGTCTC

ACCTGCACTGGAGACCCCGGGGCCTCCCGCCCGGGCTCCCGACGCCCGGCCCGCAG - UNI35508 - GCCCCGTGGAGAACTGACTCCCCAAAGACC

CAGCCCCTTTGCATCCCAAGAAGAGGGCTTGCGAGCAGAATCTTGTGTGGACGATGGAGCCATTGCCCCTGACACTGACACAGCCTCTGGGGAGGTGCCT

GAGGCTGGGCCCTCCCTCTCCTCCACCATGTGCCAAACAGGAGGCCCAGGCCCTCCACCCAGCCCCCCAGATGAGTCCCCTGATCCCCCTGACCCCCCCG

ACCCCCTTGGAGCCACATGAGGCAGGAAGCCCCATCGCTGGACAGCCACACGTCTTGGAACTGAACTGAACCGAACTCTTTTGGGCCCAGAGCCCCCTGG

CACAGCAGAGGTCTCTCCTGGCCCCATGAGGGCCACTGGCTTCAGGAACCTGGCCCCCCCCCCCCATCTTGCGTCTCCCCTTCCCCCAAGCCTGGCCCCT

GGAGGGGGCCTCTGATTCAAACCTTCGCGTGACATTTTCACATTATTT
Translation
 MPAPGALILLAAVSASGCLASPAHPD DGFALSRAPLAPPYAVVLISCSGLLAFIFLLLTCLCCKRGDVRFK EFENPEGEDCSGEYTPPAEETSSSQS

LPDVYILPLAEVSLPMPAPQPPHSD DISTPLGLSRQHLSYLQEIGSGWFGK VILGEVFSDYSPAQVVVKELRASAGPLEQRKFISEAQPYR RSLQHP

NVLQCLGVCVETLPFLLIMEFCQL GDLKRYLRAQRPPEGMSPELPPRDLRTLQRMGLEIARGLAHLHSHNYVHS SDLALRNCLLTSDLTVRIGDYGLA

HSNYK EDYYLTPERLWVPLRWAAPELLGELHGSFVLVDQSRESNVW WSLGVTLWELFEFGAQPYRHLSDEEVLAFVVRQQHVKLARPRLKLPYADYW 

WYDILQSCWRPPAQRPSASDLQLQLTYLLSERPPRPPPPPPPPRDGPFPWPWPPSHSAPRPGTLSSQFPLLDGFPGADPDDVLTVTESSRGLNLECLWEK

ARRGAGRGGGAPPWQPASAPPAPHTNPSNPFYEALSTPSVLPVISARSPSVSSEYYIRLEEHGSPPEPLFPNDWDPLDPGVPGPQAPQTPSEVPQLVSET

WASPLFPAPRPFPAQSSGSGGFLLSGWDPEGRGAGETLAGDPAEVLGEQGTAPWAEEEEEESSPGEDSSSLGGGPSRRGPLPCPLCSREGPCSCLPLERG

DAVAGWGDHPALGCPHPPEDDSSLRAERGSLADLPLVPPTSAPLEFLDPLMGAAAPQYPGRGPPPAPPPPPPPPRASAEPAASPDPPSALASPGSGLSSP

GPKPGDSGYETETPFSPEGAFPGGGAAEEEGVPRPRAPPEPPDPGAPRPPPDPGPLPLPGSQEKPTFVVQVSTEQLLMSLREDVTKNLLGDKGSTPGETG

PRKAGRSPANREKGPGPNRDLTSLVSRKKVPSRSLPVNGVTVLENGKPGVPDMKEKVAENGLESPEKEERALVNGEPMSPEAGEKVLANGVLMSPKSEEK

VAENGVLRLPRNTERPPEIGPRRVPGPWEKTPETGGLAPETLLDRAPAPCEAALPQNGLEMAPGQLGPAPKSGNPDPGTEWRVHESGGAPRAPGAGKLDL

GSGGRALGGVGTAPAGGPASAVDAKAGWVDNSRPLPPPPQPLGAQQRRPEPVPLKARPEVAQEEEPGVPDNRLGGDMAPSVDEDPLKPERKGPEMPRLFL

DLGPPQGNSEQIKA AKLSRLSLALPPLTLTPFPGPGPRRPPWEGADAGAAGGEAGGAGAPGPAEEDGEDEDEDEEDEEAAGSRDPGRTREAPVPVVVSS

ADGDTVRPLRGLLKSPRAADEPEDSELERKRKMVSFHGDVTVYLFDQ - UNI33469 - ETPTNELSVQGTPEGDTEPSTPPAPPTPPHPTTPGDGFP

NSDSGFG GGSFEWAEDFPLLPPPGPPLCFSRFSVSPALETPGPPARAPDARPAG - UNI35508 - GPVEN
Transcript ENSMUST00000118564
Sequence
GCTTTGCGTGCTCACTCCCCGGTCACTGCAATCCCATTCCCTGTACCTTTCTGAACTTCCATTCCACGATGATCCTGCCTCAGTTTCTCCAGTGAGCCCC

CCGCGAGGCTTCCCCTCCTCCCCGTGCCCCCAGTGAGCCGTGCTGCGCGCGCAGCTCTGGTCCAGCCTCATTGAGGGGACGAGTCGCAGGTATTCCTGGA

CCATGGAGACATCCTCGCCGAGGGCGGCAGTCCGCGCTTCCGG CCGCCGATTCCTCCACCTCCCTTCCATCCTGGACAAGATGCCTGCACCCGGCGCAC

TCATCCTCCTGGCGGCCGTCTCCGCCTCCGGCTGCCTGGCGTCCCCAGCGCACCCGG ATGGATTCGCTCTGAGCCGGGCCCCTTTGGCTCCGCCCTACG

CTGTGGTCCTCATTTCCTGTTCGGGTCTGCTGGCCTTCATCTTTCTCCTCCTTACCTGTCTGTGTTGCAAACGGGGTGATGTTCGTTTCAAG GAGTTTG

AGAACCCGGAAGGGGAGGACTGCTCTGGGGAGTACACCCCCCCTGCGGAGGAGACCTCCTCCTCACAGTCGCTGCCTGATGTCTATATTCTGCCGCTGGC

AGAGGTCTCACTGCCAATGCCTGCCCCGCAGCCTCCACACTCAG ACATCAGCACCCCCCTGGGCCTGAGCCGCCAGCACCTCAGCTACCTGCAGGAGAT

TGGCAGCGGCTGGTTTGGGAAG GTGATCCTCGGGGAGGTTTTCTCAGACTACTCGCCAGCCCAGGTGGTGGTGAAGGAACTCCGGGCTAGTGCCGGGCC

CCTGGAACAGCGCAAGTTCATCTCCGAGGCTCAGCCCTACAG GAGCCTGCAGCATCCCAACGTCCTCCAGTGCCTGGGCGTCTGTGTGGAGACCTTGCC

CTTCCTGTTGATCATGGAGTTCTGCCAGCTG GGGGACCTGAAGCGATACCTTCGGGCCCAGCGGCCACCTGAAGGCATGTCCCCTGAACTTCCCCCTCG

AGACCTTCGGACACTGCAGAGGATGGGTCTAGAGATTGCCCGAGGACTGGCACACCTGCACTCTCACAACTATGTGCACAG CGATCTGGCGCTGCGCAA

CTGCCTGCTAACTTCAGACCTGACTGTGCGTATTGGAGACTATGGGCTGGCGCACAGCAACTACAAG GAAGACTACTACCTGACACCCGAGCGCCTATG

GGTGCCGCTGCGCTGGGCAGCGCCCGAGCTGCTGGGCGAGCTGCACGGCAGCTTCGTGCTGGTAGATCAAAGCCGGGAGAGTAATGTCTG GTCCCTGGG

GGTGACACTCTGGGAGCTATTCGAGTTCGGGGCACAGCCCTATCGTCACCTATCGGATGAGGAGGTCCTGGCCTTTGTTGTCCGCCAGCAGCACGTGAAG

CTGGCCCGGCCCAGGCTCAAGCTGCCCTACGCTGACTATTG GTATGACATTTTGCAGTCTTGCTGGCGGCCGCCAGCCCAGCGCCCCTCAGCTTCTGAT

CTCCAGCTGCAGCTCACTTACCTGCTGTCTGAGCGGCCCCCCAGGCCCCCTCCTCCACCACCCCCTCCCCGAGATGGGCCCTTCCCCTGGCCCTGGCCCC

CCTCGCATAGTGCGCCGCGCCCAGGGACCCTGTCCTCCCAGTTCCCCCTTCTGGATGGCTTCCCCGGGGCTGACCCTGATGATGTACTCACAGTCACCGA

GAGCAGCCGTGGCCTCAACCTTGAGTGCCTGTGGGAGAAGGCCCGCCGTGGGGCAGGCCGGGGTGGGGGTGCACCTCCCTGGCAACCCGCTTCTGCGCCT

CCTGCGCCCCATACCAATCCATCCAATCCCTTCTATGAGGCGCTGTCCACCCCTAGCGTGCTTCCGGTCATCAGCGCACGCAGTCCCTCGGTGAGCAGCG

AGTACTATATCCGCCTGGAGGAGCACGGTTCTCCACCAGAGCCCCTCTTCCCCAACGACTGGGACCCGCTGGACCCAGGAGTACCCGGTCCCCAGGCCCC

CCAGACTCCCTCCGAGGTCCCTCAGCTGGTGTCCGAGACCTGGGCTTCCCCCCTCTTCCCCGCGCCCCGACCCTTCCCGGCCCAGTCCTCGGGATCAGGT

GGTTTCCTGCTGAGCGGCTGGGACCCCGAGGGCCGGGGCGCAGGAGAGACCCTGGCAGGAGATCCTGCCGAGGTGCTTGGGGAACAGGGTACCGCACCCT

GGGCCGAAGAGGAGGAGGAAGAGAGCTCCCCAGGCGAGGACAGCAGCAGCCTTGGAGGGGGACCCAGCCGCAGGGGACCCCTCCCCTGTCCCTTGTGCAG

CCGCGAGGGTCCCTGCTCCTGTCTGCCATTGGAGCGGGGGGACGCTGTGGCCGGCTGGGGGGACCACCCTGCCCTTGGTTGTCCCCACCCCCCAGAGGAC

GACTCTTCCTTGCGTGCAGAGCGGGGCTCCTTGGCCGACCTGCCTCTGGTCCCCCCTACCTCAGCCCCTCTCGAGTTTCTGGACCCCCTTATGGGGGCCG

CAGCGCCCCAGTACCCCGGGCGGGGGCCACCTCCCGCTCCCCCCCCTCCACCGCCCCCTCCCCGGGCCTCCGCGGAACCGGCCGCGTCCCCCGACCCCCC

GTCGGCCCTGGCCAGTCCAGGCTCCGGCCTATCGTCTCCGGGCCCCAAGCCGGGGGACAGCGGCTACGAGACCGAGACCCCTTTTTCCCCCGAGGGAGCC

TTCCCAGGTGGGGGGGCGGCCGAGGAGGAAGGGGTCCCTCGGCCACGGGCTCCCCCCGAGCCACCCGACCCAGGAGCGCCCCGGCCACCCCCAGACCCGG

GTCCCCTCCCACTCCCAGGGTCCCAGGAGAAGCCAACCTTTGTAGTTCAGGTGAGCACCGAGCAGCTGCTGATGTCCCTACGGGAGGATGTGACAAAGAA

CCTCCTAGGGGACAAGGGGTCGACACCCGGGGAGACAGGACCCAGGAAGGCGGGGAGAAGCCCCGCGAACAGAGAGAAGGGCCCAGGCCCGAACAGGGAC

CTGACATCCCTGGTCAGCAGGAAGAAAGTCCCCAGCAGGAGCCTTCCAGTGAACGGGGTGACAGTGTTGGAGAACGGGAAGCCAGGAGTCCCGGACATGA

AGGAGAAGGTGGCGGAGAATGGCCTGGAATCTCCGGAGAAAGAAGAGAGAGCCCTGGTGAATGGGGAGCCGATGTCCCCAGAGGCCGGGGAGAAGGTGCT

GGCGAATGGGGTTCTGATGTCCCCAAAGAGCGAGGAGAAGGTGGCAGAGAATGGGGTCCTGAGGCTGCCCAGGAACACGGAGAGGCCACCAGAGATTGGA

CCTCGGAGAGTCCCAGGGCCCTGGGAGAAGACGCCCGAGACTGGGGGTCTAGCTCCCGAGACCCTGCTGGATCGAGCCCCTGCGCCCTGCGAGGCAGCCT

TGCCCCAGAACGGCTTGGAGATGGCCCCTGGCCAGCTTGGCCCAGCCCCCAAGAGCGGGAACCCAGACCCCGGGACCGAGTGGAGAGTCCACGAGAGTGG

GGGGGCACCGAGAGCCCCCGGGGCTGGGAAGCTGGACCTCGGGAGTGGGGGCCGAGCCCTGGGGGGCGTGGGGACGGCCCCCGCCGGCGGCCCCGCAAGC

GCCGTGGACGCAAAGGCCGGATGGGTAGACAACTCGAGACCACTGCCACCTCCGCCACAGCCACTGGGGGCCCAACAGAGGAGGCCGGAGCCAGTGCCCC

TGAAAGCCAGGCCGGAGGTGGCCCAAGAGGAAGAGCCAGGGGTCCCAGACAACAGGCTCGGCGGAGACATGGCCCCCAGCGTAGACGAGGACCCCCTCAA

GCCGGAGAGGAAGGGCCCCGAGATGCCACGCTTGTTCCTGGACTTGGGACCACCTCAGGGGAACAGCGAGCAGATCAAAG CCAAACTCTCCCGGCTCTC

GCTGGCGCTCCCACCGCTCACGCTCACGCCGTTCCCGGGCCCGGGCCCGCGGCGGCCACCTTGGGAGGGCGCGGACGCAGGGGCAGCTGGCGGGGAGGCC

GGCGGGGCGGGGGCGCCGGGGCCAGCGGAGGAGGACGGGGAGGACGAGGACGAGGACGAGGAGGACGAGGAGGCAGCGGGCTCTCGGGATCCCGGGAGGA

CGCGGGAAGCCCCAGTGCCCGTCGTGGTGAGCAGCGCCGACGGGGACACGGTCCGCCCGCTGCGGGGGCTGCTCAAGTCTCCACGCGCGGCCGACGAGCC

AGAGGACAGCGAGCTGGAGAGGAAGCGCAAGATGGTCTCCTTCCACGGGGACGTGACCGTCTACCTCTTCGACCAG - UNI33469 - GAGACTCCAA

CCAACGAGTTGAGCGTCCAGGGCACCCCCGAGGGGGACACGGAGCCATCAACTCCCCCAGCGCCCCCGACGCCTCCCCACCCCACCACCCCAGGAGATGG

GTTTCCCAACAGCGACAGCGGCTTTG GCGGCAGTTTCGAGTGGGCGGAGGATTTCCCCCTCCTCCCCCCGCCAGGCCCCCCCCTGTGCTTCTCCCGCTT

CTCCGTCTCACCTGCACTGGAGACCCCGGGGCCTCCCGCCCGGGCTCCCGACGCCCGGCCCGCAG - UNI35508 - GCCCCGTGGAGAACTGACTCC

CCAAAGACCCAGCCCCTTTGCATCCCAAGAAGAGGGCTTGCGAGCAGAATCTTGTGTGGACGATGGAGCCATTGCCCCTGACACTGACACAGCCTCTGGG

GAGGTGCCTGAGGCTGGGCCCTCCCTCTCCTCCACCATGTGCCAAACAGGAGGCCCAGGCCCTCCACCCAGCCCCCCAGATGAGTCCCCTGATCCCCCTG

ACCCCCCCGACCCCCTTGGAGCCACATGAGGCAGGAAGCCCCATCGCTGGACAGCCACACGTCTTGGAACTGAACTGAACCGAACTCTTTTGGGCCCAGA

GCCCCCTGGCACAGCAGAGGTCTCTCCTGGCCCCATGAGGGCCACTGGCTTCAGGAACCTGGCCCCCCCCCCCCATCTTGCGTCTCCCCTTCCCCCAAGC

CTGGCCCCTGGAGGGGGCCTCTGATTCAAACCTTCGCGTGACATTTTCACATTATTTAAAAAAAAAAGACAAAAACAACTTTTGGAGGAAAA
Translation
METSSPRAAVRASG GRRFLHLPSILDKMPAPGALILLAAVSASGCLASPAHPD DGFALSRAPLAPPYAVVLISCSGLLAFIFLLLTCLCCKRGDVRFK

 EFENPEGEDCSGEYTPPAEETSSSQSLPDVYILPLAEVSLPMPAPQPPHSD DISTPLGLSRQHLSYLQEIGSGWFGK VILGEVFSDYSPAQVVVKEL

RASAGPLEQRKFISEAQPYR RSLQHPNVLQCLGVCVETLPFLLIMEFCQL GDLKRYLRAQRPPEGMSPELPPRDLRTLQRMGLEIARGLAHLHSHNYV

HS SDLALRNCLLTSDLTVRIGDYGLAHSNYK EDYYLTPERLWVPLRWAAPELLGELHGSFVLVDQSRESNVW WSLGVTLWELFEFGAQPYRHLSDEE

VLAFVVRQQHVKLARPRLKLPYADYW WYDILQSCWRPPAQRPSASDLQLQLTYLLSERPPRPPPPPPPPRDGPFPWPWPPSHSAPRPGTLSSQFPLLDG

FPGADPDDVLTVTESSRGLNLECLWEKARRGAGRGGGAPPWQPASAPPAPHTNPSNPFYEALSTPSVLPVISARSPSVSSEYYIRLEEHGSPPEPLFPND

WDPLDPGVPGPQAPQTPSEVPQLVSETWASPLFPAPRPFPAQSSGSGGFLLSGWDPEGRGAGETLAGDPAEVLGEQGTAPWAEEEEEESSPGEDSSSLGG

GPSRRGPLPCPLCSREGPCSCLPLERGDAVAGWGDHPALGCPHPPEDDSSLRAERGSLADLPLVPPTSAPLEFLDPLMGAAAPQYPGRGPPPAPPPPPPP

PRASAEPAASPDPPSALASPGSGLSSPGPKPGDSGYETETPFSPEGAFPGGGAAEEEGVPRPRAPPEPPDPGAPRPPPDPGPLPLPGSQEKPTFVVQVST

EQLLMSLREDVTKNLLGDKGSTPGETGPRKAGRSPANREKGPGPNRDLTSLVSRKKVPSRSLPVNGVTVLENGKPGVPDMKEKVAENGLESPEKEERALV

NGEPMSPEAGEKVLANGVLMSPKSEEKVAENGVLRLPRNTERPPEIGPRRVPGPWEKTPETGGLAPETLLDRAPAPCEAALPQNGLEMAPGQLGPAPKSG

NPDPGTEWRVHESGGAPRAPGAGKLDLGSGGRALGGVGTAPAGGPASAVDAKAGWVDNSRPLPPPPQPLGAQQRRPEPVPLKARPEVAQEEEPGVPDNRL

GGDMAPSVDEDPLKPERKGPEMPRLFLDLGPPQGNSEQIKA AKLSRLSLALPPLTLTPFPGPGPRRPPWEGADAGAAGGEAGGAGAPGPAEEDGEDEDE

DEEDEEAAGSRDPGRTREAPVPVVVSSADGDTVRPLRGLLKSPRAADEPEDSELERKRKMVSFHGDVTVYLFDQ - UNI33469 - ETPTNELSVQGT

PEGDTEPSTPPAPPTPPHPTTPGDGFPNSDSGFG GGSFEWAEDFPLLPPPGPPLCFSRFSVSPALETPGPPARAPDARPAG - UNI35508 - GPVE

N

For any suggestions or comments, please send an email to unitrap@crg.es