Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000062075 (Lmnb2)
Chromosomal location
Chr 10: 80364109 - 80380990 (-)
Description
lamin B2 Gene [Source:MGI Symbol;Acc:MGI:96796]
RefSeq_dna
NM_010722 
RefSeq_peptide
NP_034852.2 
UniGene
Mm.408993 Mm.7362 
MGI
MGI:96796 
Uniprot/SWISSPROT
P21619 
Uniprot/SPTREMBL
Q3V159 
Human Ortholog
ENSG00000176619 (LMNB2)
Omim 608709 - BARRAQUER-SIMONS SYNDROME  
UniTrap UNI2215
Vector Insertion
Chr 10: 80372791 - 80380708
Public Clones XP0272 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI759
Vector Insertion
Chr 10: 80365646 - 80365956
Public Clones CJ0144 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 97% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000105332
Sequence
ATGGGGGAGTCGGAATCCATGAGAGGCACTGGAGAGGGATGCGGGAGGGACTGCCCGGAGGCAGCCCGCCCTTTGATGGAGACCGTGGAGGGAGCTCTGC

CGGAGCTCAGAGGGAGGCCTCTGAGGGAGTATGTGAAACGACGTCCGAGGGGGCTTGGGAAGACCCCCGTGGAGGATCCTGTGAAGTCAGAGGGGGCTGT

GGGGTATCCCAGGACTTGGAACAACCACCTCAGGGTCCCCACAAGAGAGCAG GAGGTACGGGAGACCCGACGGAGGCACGAGCGGCGCTTGGTGGAGGT

GGACAGCAGCCGGCAACAGGAATATGACTTCAAGATGGCTCAGGCCCTGGAGGACCTGCGCAGTCAGCACGATGAGCAAGTGCGCCTGTACCGGGTAGAA

CTGGAGCAGACCTACCAGGCCAAG CTGGACAACGCCAAGCTGCTCTCGGACCAGAATGACAAGGCAGCCCATGCAGCCCGCGAGGAGCTCAAGGAGGCC

CGCATGCGCGTGGAGTCCCTCAGCTACCAGCTTTTAGGCCTCCAAAAGCAG GCCAGTGCTGCAGAGAACCACATCCATGAGCTGGAGGAGGCCTTGGCT

GGGGAGCGTGACAAGTTCCGCAAGATGCTGGACGCTAAGGAACAGGAGATGACGGAGGTGCGGGACGCCATGCAGCAGCAGCTGGCAGAGTACCAAGAGC

TGCTGGACATTAAGCTGGCCCTGGACATGGAGATAAGCGCCTACCGCAAGCTGCTGGAGGGCGAGGAGGAGAG GCTGAAGCTGTCTCCCAGCCCTTCAT

CACGGATCACCATCTCTCGGGCCACATCGAGCAGCAGCAGCAGCAGCGGGGTTGGCATGTCTGTGGGCCAGGGCCGGGGCAAGCGCCGGCGGCTGGAGAC

TGAGGACACCTCAGGCTCACCCAGCAGGGCTTCCAGAGTGAGCAGCGGCTCCCGCCTGGCTCAGCAGACTGTGGCCACGGGTGTTGTGAACATCGACGAG

GTGGACCCAGAGGGCAGGTTCGTGCGCCTTAAGAACTCTTCAGACAAG GACCAGTCTTTGGGGAACTGGAGGATCAAGAGACAGGTTCTGGAGGGTGAG

GACATTGCCTACAAGTTCACACCCAAGTATGTCCTGCGGGCCGGCCAGACTGTCACG GTGTGGGCAGCTGGCGCAGGGGCTACCCACAGTCCCCCATCA

ACCCTTGTGTGGAAAAGCCAGACCAACTGGGGCCCTGGGGAGAGCTTCCGCACTGCCCTGGTCAGTGCCGACGGTGAG GAGGTGGCCGTGAAGGCTGCA

AAGCACTCATCTGTCCAGGGGAGGGAGAACGGGGAAGAGGAGGAAGAGGAAGAGGCAGAATTCGGTGAAGAGGACCTCTTCCACCAGCAG - UNI759 

- GGGGACCCAAGGACTACCTCAAGGGGCTGCCGACTGATGTGAAACCTGCCCCACGGTCACCATGGTCCCCAGAGCCCCTAAAACTACTTTTTTATGGT

CTGCTCTCACTAGTCCTTGGTCTGTTTCTCGATGACTGTTAAGCAACCATGAGAATGTGGGTGGGCTCTGCTGGGTTTCCGAGATGGAGGTGCCCTCTGC

CCACCGGCCTGACCTGGCCCCATGCCGTCAAGATGGTATAGAGGCCTGGGGCTAGGAACCCGCAGGCTGAGGGACTTGGGCCTGGATCTGGGGCAGGAGA

ATGGCTGCTAGCTCAGGGTGGACTTTGTATGAAACTGGTGATTCAGTTGTTTTCTTTGAAGCCTTTCAAATCAAATCAAATTCAGAATCCAAGAGTGCTG

TGGGGCCCACTAGCCTGTCAGGATGTGGTGGCTCTTAGGACACAGGGCAGACCCTCCTCTCCTGGAGTTGATGGCACCTGAAACCAGGGATGGCCCAGCT

TTGTGCTCTGAATCTGAAGGGTTTATAACAGTCCCCAGCTCCAGGGCATTCACAGGCTTCTCTGGTCCCAGATTCTGAATTGTTCTAGTCCCTTCTAAAG

CGGAGGACCAAGGAGGAGCGAGTTCACACATGGGACGACGCCTCCCATCCTAAGACTGAAGGGGACAGGCAAACCGTGGGCGTTGTGCCTTCAGGAGCAA

AGGCTGCAGGTTCCCAGCCAGTGACTGCTCACATGAGTGTGGCCACACTAGCTATGCTCCTGGCCTCTCCTGTATGAATACTGTGTGGCCCCTCTGTGCC

CCACCTCGATGGCAAGGCCTGGAAACTTGCTTCCCTGCAACTTAGTGCCAGGAGCCAGCCAGTTTCACCTGTCACCTCCCCACCACTGACACATGGTATT

TTTTTAAAGAATATTTATTTTTTTACATCGGTCAGTAACGCAGCTCACTGGGATGATGCTCTGGGGGTTCAGGCCTGGAGCTGCCACAACTGGCAGCTTC

CTTTACTGAGCTAGGGCGAGTTCTTTCTCTCTCCTGGCACAGCTGATGGTAGGAAGAGTCCAGGCCTAGTCTTCCCCCAAGGCAAGAGCTCTTGGCCACA

GGATGCCACCACTGCCACCAACCTCCAGAACCCACCAGCCACCTCCTGCTTCTAGATACCTCCGTTTTCTTTGTGACCGGCGTTGGATCCTGGATAGTTA

TGGCTGGCTGCAGTCACTGCGCAGCTCTGCTGCCTTGCCCACAGGGCAGGTGTACTCTGCACTGGAGCTAGCTTCCTTGTATTTGAGGAGCAGGTCTAGA

GTAATCTGCAGGTCCTCAGGGGTCTGTTTCTGGCCCTGGCTAGGTGAGATGGTTACCGGAGTGGCACTGCTGCTGGGGAGCCGCCGGCACTGCGCACATC

GCTCAGCTCTACAGATTGTTTCTTTTATAAGATGCATGCCAAACGTGTGTTCCACCTTTTCTTTTACGCCTATGATTTGTAATATACATTTTACAACTGG

AAACTTTTGTATACTCAAATAAACATTGACTTTAACTGC
Translation
MGESESMRGTGEGCGRDCPEAARPLMETVEGALPELRGRPLREYVKRRPRGLGKTPVEDPVKSEGAVGYPRTWNNHLRVPTREQ EVRETRRRHERRLVE

VDSSRQQEYDFKMAQALEDLRSQHDEQVRLYRVELEQTYQAK LDNAKLLSDQNDKAAHAAREELKEARMRVESLSYQLLGLQKQ ASAAENHIHELEEA

LAGERDKFRKMLDAKEQEMTEVRDAMQQQLAEYQELLDIKLALDMEISAYRKLLEGEEER RLKLSPSPSSRITISRATSSSSSSSGVGMSVGQGRGKRR

RLETEDTSGSPSRASRVSSGSRLAQQTVATGVVNIDEVDPEGRFVRLKNSSDK DQSLGNWRIKRQVLEGEDIAYKFTPKYVLRAGQTVT VWAAGAGAT

HSPPSTLVWKSQTNWGPGESFRTALVSADGE EVAVKAAKHSSVQGRENGEEEEEEEAEFGEEDLFHQQ - UNI759 - GDPRTTSRGCRLM
Transcript ENSMUST00000057623
Sequence
GGCGCCATCTTCCGCGGCGCGGATTGAATGAGCGCGCCGCATTCGGGCAACCGAGGTGATTCTCCCGCCGCCGCCACCTCCGCCATGGCGTCTCTGCCGC

CCCACGCGGGGCCCGCCACGCCGCTGTCGCCCACGCGTCTGTCTCGGCTGCAGGAGAAGGAGGAGCTCCGTGAGCTCAACGACCGCCTGGCACACTACAT

CGACCGTGTCCGCGCGCTGGAGCTGGAGAATGATAGGTTGCTGCTCCGGATCTCCGAGAAGGAGGAGGTGACCACTCGCGAG - UNI2215 - GTGAG

TGGCATCAAGACCCTGTACGAGTCAGAGCTGGCTGACGCCCGACGGGTACTGGATGAGACGGCCCGTGAACGTGCCCGGCTGCAGATTGAAATTGGAAAG

GTGCAGGCTGAGCTAGAGGAGGCCAGGAAGAG TGCCAAGAAGCGGGAAGGTGAGCTCACAGTGGCCCAGGGCCGAGTGAAGGATCTGGAATCACTGTTT

CACCGGAGTGAGGCTGAGCTGGCCACAGCCCTCAGTGACAAGCAGGGCCTGGAGACAGAGGTGGCAGAGCTTCGAGCACAGCTGGCCAAG GCAGAAGAT

GGTCATGCTGTGGCCAAGAAGCAGTTGGAGAAGGAGACGCTGATGCGTGTGGACCTGGAGAACCGATGCCAGAGCCTGCAGGAGGAGCTGGCTTTCAGCA

AGAGTGTGTTTGAGGAG GAGGTACGGGAGACCCGACGGAGGCACGAGCGGCGCTTGGTGGAGGTGGACAGCAGCCGGCAACAGGAATATGACTTCAAGA

TGGCTCAGGCCCTGGAGGACCTGCGCAGTCAGCACGATGAGCAAGTGCGCCTGTACCGGGTAGAACTGGAGCAGACCTACCAGGCCAAG CTGGACAACG

CCAAGCTGCTCTCGGACCAGAATGACAAGGCAGCCCATGCAGCCCGCGAGGAGCTCAAGGAGGCCCGCATGCGCGTGGAGTCCCTCAGCTACCAGCTTTT

AGGCCTCCAAAAGCAG GCCAGTGCTGCAGAGAACCACATCCATGAGCTGGAGGAGGCCTTGGCTGGGGAGCGTGACAAGTTCCGCAAGATGCTGGACGC

TAAGGAACAGGAGATGACGGAGGTGCGGGACGCCATGCAGCAGCAGCTGGCAGAGTACCAAGAGCTGCTGGACATTAAGCTGGCCCTGGACATGGAGATA

AGCGCCTACCGCAAGCTGCTGGAGGGCGAGGAGGAGAG GCTGAAGCTGTCTCCCAGCCCTTCATCACGGATCACCATCTCTCGGGCCACATCGAGCAGC

AGCAGCAGCAGCGGGGTTGGCATGTCTGTGGGCCAGGGCCGGGGCAAGCGCCGGCGGCTGGAGACTGAGGACACCTCAGGCTCACCCAGCAGGGCTTCCA

GAGTGAGCAGCGGCTCCCGCCTGGCTCAGCAGACTGTGGCCACGGGTGTTGTGAACATCGACGAGGTGGACCCAGAGGGCAGGTTCGTGCGCCTTAAGAA

CTCTTCAGACAAG GACCAGTCTTTGGGGAACTGGAGGATCAAGAGACAGGTTCTGGAGGGTGAGGACATTGCCTACAAGTTCACACCCAAGTATGTCCT

GCGGGCCGGCCAGACTGTCACG GTGTGGGCAGCTGGCGCAGGGGCTACCCACAGTCCCCCATCAACCCTTGTGTGGAAAAGCCAGACCAACTGGGGCCC

TGGGGAGAGCTTCCGCACTGCCCTGGTCAGTGCCGACGGTGAG GAGGTGGCCGTGAAGGCTGCAAAGCACTCATCTGTCCAGGGGAGGGAGAACGGGGA

AGAGGAGGAAGAGGAAGAGGCAGAATTCGGTGAAGAGGACCTCTTCCACCAGCAG - UNI759 - GGGGACCCAAGGACTACCTCAAGGGGCTGCCGA

CTGATGTGAAACCTGCCCCACGGTCACCATGGTCCCCAGAGCCCCTAAAACTACTTTTTTATGGTCTGCTCTCACTAGTCCTTGGTCTGTTTCTCGATGA

CTGTTAAGCAACCATGAGAATGTGGGTGGGCTCTGCTGGGTTTCCGAGATGGAGGTGCCCTCTGCCCACCGGCCTGACCTGGCCCCATGCCGTCAAGATG

GTATAGAGGCCTGGGGCTAGGAACCCGCAGGCTGAGGGACTTGGGCCTGGATCTGGGGCAGGAGAATGGCTGCTAGCTCAGGGTGGACTTTGTATGAAAC

TGGTGATTCAGTTGTTTTCTTTGAAGCCTTTCAAATCAAATCAAATTCAGAATCCAAGAGTGCTGTGGGGCCCACTAGCCTGTCAGGATGTGGTGGCTCT

TAGGACACAGGGCAGACCCTCCTCTCCTGGAGTTGATGGCACCTGAAACCAGGGATGGCCCAGCTTTGTGCTCTGAATCTGAAGGGTTTATAACAGTCCC

CAGCTCCAGGGCATTCACAGGCTTCTCTGGTCCCAGATTCTGAATTGTTCTAGTCCCTTCTAAAGCGGAGGACCAAGGAGGAGCGAGTTCACACATGGGA

CGACGCCTCCCATCCTAAGACTGAAGGGGACAGGCAAACCGTGGGCGTTGTGCCTTCAGGAGCAAAGGCTGCAGGTTCCCAGCCAGTGACTGCTCACATG

AGTGTGGCCACACTAGCTATGCTCCTGGCCTCTCCTGTATGAATACTGTGTGGCCCCTCTGTGCCCCACCTCGATGGCAAGGCCTGGAAACTTGCTTCCC

TGCAACTTAGTGCCAGGAGCCAGCCAGTTTCACCTGTCACCTCCCCACCACTGACACATGGTATTTTTTTAAAGAATATTTATTTTTTTACATCGGTCAG

TAACGCAGCTCACTGGGATGATGCTCTGGGGGTTCAGGCCTGGAGCTGCCACAACTGGCAGCTTCCTTTACTGAGCTAGGGCGAGTTCTTTCTCTCTCCT

GGCACAGCTGATGGTAGGAAGAGTCCAGGCCTAGTCTTCCCCCAAGGCAAGAGCTCTTGGCCACAGGATGCCACCACTGCCACCAACCTCCAGAACCCAC

CAGCCACCTCCTGCTTCTAGATACCTCCGTTTTCTTTGTGACCGGCGTTGGATCCTGGATAGTTATGGCTGGCTGCAGTCACTGCGCAGCTCTGCTGCCT

TGCCCACAGGGCAGGTGTACTCTGCACTGGAGCTAGCTTCCTTGTATTTGAGGAGCAGGTCTAGAGTAATCTGCAGGTCCTCAGGGGTCTGTTTCTGGCC

CTGGCTAGGTGAGATGGTTACCGGAGTGGCACTGCTGCTGGGGAGCCGCCGGCACTGCGCACATCGCTCAGCTCTACAGATTGTTTCTTTTATAAGATGC

ATGCCAAACGTGTGTTCCACCTTTTCTTTTACGCCTATGATTTGTAATATACATTTTACAACTGGAAACTTTTGTATACTCAAATAAACATTGACTTTAA

CTGC
Translation
MASLPPHAGPATPLSPTRLSRLQEKEELRELNDRLAHYIDRVRALELENDRLLLRISEKEEVTTRE - UNI2215 - VSGIKTLYESELADARRVLDE

TARERARLQIEIGKVQAELEEARKS SAKKREGELTVAQGRVKDLESLFHRSEAELATALSDKQGLETEVAELRAQLAK AEDGHAVAKKQLEKETLMRV

DLENRCQSLQEELAFSKSVFEE EVRETRRRHERRLVEVDSSRQQEYDFKMAQALEDLRSQHDEQVRLYRVELEQTYQAK LDNAKLLSDQNDKAAHAAR

EELKEARMRVESLSYQLLGLQKQ ASAAENHIHELEEALAGERDKFRKMLDAKEQEMTEVRDAMQQQLAEYQELLDIKLALDMEISAYRKLLEGEEER R

LKLSPSPSSRITISRATSSSSSSSGVGMSVGQGRGKRRRLETEDTSGSPSRASRVSSGSRLAQQTVATGVVNIDEVDPEGRFVRLKNSSDK DQSLGNWR

IKRQVLEGEDIAYKFTPKYVLRAGQTVT VWAAGAGATHSPPSTLVWKSQTNWGPGESFRTALVSADGE EVAVKAAKHSSVQGRENGEEEEEEEAEFGE

EDLFHQQ - UNI759 - GDPRTTSRGCRLM

For any suggestions or comments, please send an email to unitrap@crg.es