Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000062077 (Trim54)
Chromosomal location
Chr 5: 31419085 - 31440003 (+)
Description
tripartite motif-containing 54 Gene [Source:MGI (curated);Acc:Trim54-001]
RefSeq_dna
NM_021447 
RefSeq_peptide
NP_067422.1 
UniGene
Mm.143796 
MGI
MGI:1889623 
Uniprot/SWISSPROT
Q9ERP3 
Uniprot/SPTREMBL
Q3KNI7 Q3KNI8 Q8CEL3 
Human Ortholog
ENSG00000138100 (TRIM54)
Omim not available
UniTrap UNI35960
Vector Insertion
Chr 5: 31419451 - 31433414
Public Clones CMHD-GT_258H1-3 (cmhd) IST14822C8 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 15% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI21322
Vector Insertion
Chr 5: 31438415 - 31438542
Public Clones not available
Private Clones OST334295 (lexicon)
Severity of mutation (?) Insertion after 55% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000114637
Sequence
GGAAATAGACAGGGGTGAGAGGAGCTGTTAGGGGAAGGGACAGGACTCTTCCAAGAGGGAGCAATAGCCGGGATCCCAAGAATCCAGTCAGCCTAAACTG

ACCGAGGAAGGGTGCACAGGCAGGGGAGAAGGCCAACGACAGGGCCACAGCGAGGCAGGCTCCAGAGCGCCGCGGGATGAACTTCACGGTGGGTTTCAAG

CCGCTGCTAGGGGATGCGCACAACATGGACAACTTGGAGAAGCAGCTCATTTGCCCCATCTGCCTGGAGATGTTCTCCAAGCCCGTGGTGATCTTGCCCT

GCCAACACAACCTGTGCCGCAAGTGTGCCAACGACGTCTTCCAG - UNI35960 - GCCTCTAATCCTCTGTGGCAATCCCGGGGCTCCACAACGGTG

TCTTCAGGAGGACGTTTCCGATGCCCATCTTGTAGGCACGAGGTTGTCCTGGACAGGCATGGTGTCTATGGCCTGCAGCGGAACCTGCTAGTGGAGAACA

TCATTGACATCTACAAGCAGGAGTCCTCCCG GCCACTGCACGCCAAGGCTGAACAGCACCTCATGTGTGAGGAGCACGAGGACGAGAAGATCAACATCT

ACTGCCTGAGCTGCGAGGTGCCCACCTGCTCTCTCTGCAAGGTTTTCGGCGCCCACAAGGACTGTGAGGTGGCCCCTCTGCCCACCATTTACAAACGCCA

GAAG AGTGAGCTGAGCGATGGCATCGCGATGCTGGTGGCGGGCAATGACCGTGTGCAGGCAGTGATCACCCAGATGGAGGAGGTGTGCCAGACCATTGA

G - UNI21322 - GACAACAGCCGCAGACAGAAGCAACTGTTAAACCAGAGGTTCGAGACCCTGTGCGCGGTTTTGGAGGAGCGCAAGGGCGAACTGC

TTCAAGCACTGGCCCGGGAGCAGGAGGAGAAGTTGCAGCGCGTGCGGGGCCTCATCCGCCAGTACGGAGACCACTTGGAGGGCTCCTCAAAGCTGGTGGA

GTCCGCCATCCAGTCCATGGAGGAGCCGCAGATGGCTCTCTACCTCCAG CAGGCAAAGGAGCTGATCAACAA GGTCGGGGCAATGTCGAAGGTGGAGC

TGGCAGGACGGCCGGAGCCAGGCTATGAGAGCATGGAGCAATTCTCTGTGAGCGTGGAGCACGTGGCCGAAATGTTGCGAACCATCGACTTCCAGCCGG 

GCGCCGCTGGGGATGAAGAGGATGACGACATGGCTTTGGATGGGGAGGAGGGCAATGCGGGGCTGGAGGAGGAGCGGCTGGACGTGCCAGAAG GCCTGC

ACTGACCCGACTCTGATCCAGAGCGCACACCCGAAGCGGGAGCCAAGGGATGCTGAGGATCTGCGCAGAGACCACCGCGCCACCAAGCTCGGCTTCCCGC

CCCCGGGAAGGTTCTCAATAAAGGACTCAAGTGTCCCACGTC
Translation
MNFTVGFKPLLGDAHNMDNLEKQLICPICLEMFSKPVVILPCQHNLCRKCANDVFQ - UNI35960 - ASNPLWQSRGSTTVSSGGRFRCPSCRHEVV

LDRHGVYGLQRNLLVENIIDIYKQESSR RPLHAKAEQHLMCEEHEDEKINIYCLSCEVPTCSLCKVFGAHKDCEVAPLPTIYKRQK SELSDGIAMLVA

GNDRVQAVITQMEEVCQTIE - UNI21322 - DNSRRQKQLLNQRFETLCAVLEERKGELLQALAREQEEKLQRVRGLIRQYGDHLEGSSKLVESAIQ

SMEEPQMALYLQ QAKELINK KVGAMSKVELAGRPEPGYESMEQFSVSVEHVAEMLRTIDFQPG GAAGDEEDDDMALDGEEGNAGLEEERLDVPEG G

LH
Transcript ENSMUST00000114638
Sequence
AAGGAGTGTAGACAGAGTGTCTGGAAATAGACAGGGGTGAGAGGAGCTGTTAGGGGAAGGGACAGGACTCTTCCAAGAGGGAGCAATAGCCGGGATCCCA

AGAATCCAGTCAGCCTAAACTGACCGAGGAAGGGTGCACAGGCAGGGGAGAAGGCCAACGACAGGGCCACAGCGAGGCAGGCTCCAGAGCGCCGCGGGAT

GAACTTCACGGTGGGTTTCAAGCCGCTGCTAGGGGATGCGCACAACATGGACAACTTGGAGAAGCAGCTCATTTGCCCCATCTGCCTGGAGATGTTCTCC

AAGCCCGTGGTGATCTTGCCCTGCCAACACAACCTGTGCCGCAAGTGTGCCAACGACGTCTTCCAG - UNI35960 - GCCTCTAATCCTCTGTGGCA

ATCCCGGGGCTCCACAACGGTGTCTTCAGGAGGACGTTTCCGATGCCCATCTTGTAGGCACGAGGTTGTCCTGGACAGGCATGGTGTCTATGGCCTGCAG

CGGAACCTGCTAGTGGAGAACATCATTGACATCTACAAGCAGGAGTCCTCCCG GCCACTGCACGCCAAGGCTGAACAGCACCTCATGTGTGAGGAGCAC

GAGGACGAGAAGATCAACATCTACTGCCTGAGCTGCGAGGTGCCCACCTGCTCTCTCTGCAAGGTTTTCGGCGCCCACAAGGACTGTGAGGTGGCCCCTC

TGCCCACCATTTACAAACGCCAGAAG AGTGAGCTGAGCGATGGCATCGCGATGCTGGTGGCGGGCAATGACCGTGTGCAGGCAGTGATCACCCAGATGG

AGGAGGTGTGCCAGACCATTGAG - UNI21322 - GACAACAGCCGCAGACAGAAGCAACTGTTAAACCAGAGGTTCGAGACCCTGTGCGCGGTTTTG

GAGGAGCGCAAGGGCGAACTGCTTCAAGCACTGGCCCGGGAGCAGGAGGAGAAGTTGCAGCGC - UNI21322 - CTGGACGTGCCAGAAG GCTCAG

GCCTGCACTGACCCGACTCTGATCCAGAGCGCACACCCGAAGCGGGAGCCAAGGGATGCTGAGGATCTGCGCAGAGACCACCGCGCCACCAAGCTCGGCT

TCCCGCCCCCGGGAAGGTTCTCAATAAAGGACTCAAGTGTCCC
Translation
MNFTVGFKPLLGDAHNMDNLEKQLICPICLEMFSKPVVILPCQHNLCRKCANDVFQ - UNI35960 - ASNPLWQSRGSTTVSSGGRFRCPSCRHEVV

LDRHGVYGLQRNLLVENIIDIYKQESSR RPLHAKAEQHLMCEEHEDEKINIYCLSCEVPTCSLCKVFGAHKDCEVAPLPTIYKRQK SELSDGIAMLVA

GNDRVQAVITQMEEVCQTIE - UNI21322 - DNSRRQKQLLNQRFETLCAVLEERKGELLQALAREQEEKLQR - UNI21322 - LDVPEG GSG

LH
Transcript ENSMUST00000013771
Sequence
AAGGAGTGTAGACAGAGTGTCTGGAAATAGACAGGGGTGAGAGGAGCTGTTAGGGGAAGGGACAGGACTCTTCCAAGAGGGAGCAATAGCCGGGATCCCA

AGAATCCAGTCAGCCTAAACTGACCGAGGAAGGGTGCACAGGCAGGGGAGAAGGCCAACGACAGGGCCACAGCGAGGCAGGCTCCAGAGCGCCGCGGGAT

GAACTTCACGGTGGGTTTCAAGCCGCTGCTAGGGGATGCGCACAACATGGACAACTTGGAGAAGCAGCTCATTTGCCCCATCTGCCTGGAGATGTTCTCC

AAGCCCGTGGTGATCTTGCCCTGCCAACACAACCTGTGCCGCAAGTGTGCCAACGACGTCTTCCAG - UNI35960 - GCCTCTAATCCTCTGTGGCA

ATCCCGGGGCTCCACAACGGTGTCTTCAGGAGGACGTTTCCGATGCCCATCTTGTAGGCACGAGGTTGTCCTGGACAGGCATGGTGTCTATGGCCTGCAG

CGGAACCTGCTAGTGGAGAACATCATTGACATCTACAAGCAGGAGTCCTCCCG GCCACTGCACGCCAAGGCTGAACAGCACCTCATGTGTGAGGAGCAC

GAGGACGAGAAGATCAACATCTACTGCCTGAGCTGCGAGGTGCCCACCTGCTCTCTCTGCAAGGTTTTCGGCGCCCACAAGGACTGTGAGGTGGCCCCTC

TGCCCACCATTTACAAACGCCAGAAG AGTGAGCTGAGCGATGGCATCGCGATGCTGGTGGCGGGCAATGACCGTGTGCAGGCAGTGATCACCCAGATGG

AGGAGGTGTGCCAGACCATTGAG - UNI21322 - GACAACAGCCGCAGACAGAAGCAACTGTTAAACCAGAGGTTCGAGACCCTGTGCGCGGTTTTG

GAGGAGCGCAAGGGCGAACTGCTTCAAGCACTGGCCCGGGAGCAGGAGGAGAAGTTGCAGCGCGTGCGGGGCCTCATCCGCCAGTACGGAGACCACTTGG

AGGGCTCCTCAAAGCTGGTGGAGTCCGCCATCCAGTCCATGGAGGAGCCGCAGATGGCTCTCTACCTCCAG CAGGCAAAGGAGCTGATCAACAA GGTC

GGGGCAATGTCGAAGGTGGAGCTGGCAGGACGGCCGGAGCCAGGCTATGAGAGCATGGAGCAATTCTCTGTGAGCGTGGAGCACGTGGCCGAAATGTTGC

GAACCATCGACTTCCAGCCGG GCGCCGCTGGGGATGAAGAGGATGACGACATGGCTTTGGATGGGGAGGAGGGCAATGCGGGGCTGGAGGAGGAGCGGC

TGGACGTGCCAGAAG GCTCAGGCCTGCACTGACCCGACTCTGATCCAGAGCGCACACCCGAAGCGGGAGCCAAGGGATGCTGAGGATCTGCGCAGAGAC

CACCGCGCCACCAAGCTCGGCTTCCCGCCCCCGGGAAGGTTCTCAATAAAGGACTCAAGTGTCCC
Translation
MNFTVGFKPLLGDAHNMDNLEKQLICPICLEMFSKPVVILPCQHNLCRKCANDVFQ - UNI35960 - ASNPLWQSRGSTTVSSGGRFRCPSCRHEVV

LDRHGVYGLQRNLLVENIIDIYKQESSR RPLHAKAEQHLMCEEHEDEKINIYCLSCEVPTCSLCKVFGAHKDCEVAPLPTIYKRQK SELSDGIAMLVA

GNDRVQAVITQMEEVCQTIE - UNI21322 - DNSRRQKQLLNQRFETLCAVLEERKGELLQALAREQEEKLQRVRGLIRQYGDHLEGSSKLVESAIQ

SMEEPQMALYLQ QAKELINK KVGAMSKVELAGRPEPGYESMEQFSVSVEHVAEMLRTIDFQPG GAAGDEEDDDMALDGEEGNAGLEEERLDVPEG G

SGLH

For any suggestions or comments, please send an email to unitrap@crg.es