Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000062151 (Unc13c)
Chromosomal location
Chr 9: 73327229 - 73781374 (-)
Description
unc-13 homolog C (C. elegans) Gene [Source:MGI Symbol;Acc:MGI:2149021]
Human Ortholog
not available
Omim not available
UniTrap UNI35484
Vector Insertion
Chr 9: 73426175 - 73477042
Public Clones IST14629B7 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000093818
Sequence
ATGGTGGCCAGTCTCTTTAAGAGCTTGATTTTAGCTTATATACATAAGCTTTGCAAAGGAATGTTTACAAAGAAATTGGGAAATACAACCAAAAAGAAAG

AGAATCGTCAGCAGAAAAAAGATCAAGATTTTCCAACTGCTGGCCACACCAAACCCCCTAAATTGTCAAATGCCCTGAAAAGCACTGTAAAAAAGATTGC

AAAGTGCTCATCTACCCGGAACTTCTCCATAGAAGACGAAGAGGGTCACAAAGACTTCTCCCTGTCACCCACATTCAGTTACCGAGTTGCTATCGCCAAT

GGCCTGCAAACAGCCGTGACCAACAGCGATGAGGATCTGCTCCAGGAGCTGTCTTCCATCGAGAGCTCGTACTCTGAATCCTTCAATGAGCTAAGGAGCA

GCACGGAAAACCAGGTCCAATCAACACACACCATGCCTGTCCGACGTAACAGGAAGAGCTCGAGCAGTTTGGCACCTTCTGAGGGCAGCTCAGATGGGGA

GCGCACCCTCCACACCTTAAAACTGGGTGCTCTACGGAAACTGAGGAAATGGAAGAAGAGCCAAGAGTGCGTCTCCTCAGACTCGGAGTTGAGCACCGTC

AAGAAAACCTGGGGCATAAGAAGCAAATCATTAGATAGAACTGCCCGGAACCCAAAGACAAATGTCTTAGAGCCAGGGTTCAGCTCCTCTGGCTGCATTA

GCCAAACCCACGATGTCATGGAAATGATCTTTAAAGAGCTTCAGGGTATAAGTCAGATCGAAACAGAACTTTCCGAACTCCGAGGGCACGTGAATGCTCT

CAAGTACTCTATCGATGAAATCTCCAGCAGTGTGGAGGTAGTCCAGAGCGAGATCGAACAGCTTCGAACAGGGTTTGTCCAGGCTCGAAGGGAAACTCGA

GACATCCACGATTACATTAAACACTTGGGTCACATGGGGAGTAAGGTAAGCCTGAGATTTTTAAATGTGCCTGAAGAAAGACACGAGTACGTGGAAAGTG

TGGTGTACCAAATTCTTATAGATAAAATGGGTTTCTCAGATGTACCGAATGCTATTAAAATTGAATTTGCTCAGAGGATAGGGCAGCAAAGGGACTGCCC

AAATGCAAAACCTCGACCCATCCTAGTGTACTTTGAAACCCCTCAGCAAAGGGATTCTGTCTTAAAGAAATCGTATAAGCTGAAAGGTACAGGCATCGGG

ATCTCCACAGATATTCTAACTTATGATATCAGAGAACGGAAAGAAAAAGGGGTATTGCCATCTTCCCAGACATACGAAAGCATGGATATGAAGTTATCCA

CGCCAGAGCCCAAAGCCAAGAAGAACGCTTGGCTGTCACCCAATGACAGTGACAGAGAGCTGGAGTCAGACCTCAGCAGAAGCAGCTATGCTGACTCTCC

GGCAAAGGGAAGTTCTTCTAAATCCAGCTCAAAGTCACACAGTGCTCGGTCCAAGAACAAAGCAGCTAACAGCAGAACATCACAGAAGTCAGACTACAAT

AAACGGCCCTCCCAACCGCCAGCATCAAGTACCCCAGAAAAGCAAACACCTCACTATGTGGAGGCCACACCACCACTCTGGCATTCACAGAGTGACTTCT

TCACTCTTAAACTTAGTCGCTCCGAATCGGATTTCTCCAAATTGTGTCAATCTTATTCAGAGGATTTTTCTGAAAGCCAGTTTTTCTGTCGAACTAATGG

GAGCTCCCTCCTTTCCTCGTCTGACCGGGAACTTTGGCAGAGGAAACAGGAGGGCATGCCTGCCTTGTACCACCGTCTTCAGGACCAGGGTTTGGATGAG

ACTATTCCAGCAGTGCCAGGGCAGGCTGAAATTGAGAATACAGAAACAGTAGACAGCGGTATGAGCAACAGCATGGTGTGTGCATCTGGAGACCGAAGCA

ATTACAGCGGTTCTCAGCTCTCATTGCACGAGGACCTGTCTCCATGGAAGGAGTGGAATCAAGCAGGGCAAGGAACTGATGATGTTGGCTTAGATTCATC

TACCCAGGAACCTTTTGACTACGATACCAACAGTTTGTCTGACCAACAGCTGGATCTCTCTAGCAAAGACCTAGATGACCTTGGCAAGTGCCACAGCGAC

CTGCAAGATGACTCTGAAAGCTATGATTTAACCCAGGATGACAACTCCTCTCCATGCCCTGGATTGGATAATGAACCACAAGGCCAGTGGGTTGGCCAGT

ACGACTCTTATCAGGAAGCCAATTCTAATGACCTGTATCCCAACCAAAGCCATCCATCCATGATGTATAGAAGTCAAAGCGAACTGCAAAGTGATGATTC

AGAGGGGGCCCAGCCCAAGTCCTGGCACAGTCGGCTAAGCATTGACCTTTCTGATAAGACTTTTAAGTTCCCCAAATTTGGATCTACTCTTCAGAGAGCA

AAGTCAGCCCTGGAAGTGGTGTGGAACAAGAGCACACAGAGTCTCAGTGGGTGTGAGGACAGCGGCTCTTCCTTAATGGGGAGATTTCGGACATTATCAC

AATCCACCGCGAACGAGTCAAGTACCACCCTTGACTCTGATATCTACACGGAACCCTATTACTATAAAGCCGAGGAAGAGGAGGACTACTGTGAACCAGT

GGCTGACAGTGAGACAGATTATGTTGAAGTGATGGAGCAGGTCCTAGCTAAGCTAGAAAACAGGACTAGTATCACTGAAGTAAACGAACACATTAAAGAC

TATGACCACCCTTCCTATGAAACTCCTTACGAGACCCCGCAAGATGAGGGCTATGATGGGCAGGCTGATGACATCATTAGTGAAGGAGAACTGGAAACCT

TAAATGAACCAGCAGTTGAAATGGAATTAGCAGAAGATGAGAACCAAAACCTCCCTGCAGAGTCACTGGAGGTCATGAAGCCAAAGAGAATCAGGCCTTC

CTTCAAAGAAGCAGCTTTAAGGGCCTATAAGAAGCAGATGGCAGAGCTGGAAGAGAAGATCCTGGCTGGAG ATAGCAGCTCTATGGATGAAAAG GCTC

GAATAGTAAGTGGCAATGATTTGGATGCTTCCAAATTCTCCGCACTCCAGGTGTTCGGTGG GGCTGGGCGTGGACTGTATGGTATTGATAGCATGCCTG

ACCTCCGCAGGAAAAAGACATTGCCTATTGTGCGGGATGTG TTCAGACCCTGGCTGCCCGGAAATCTGGTCTCTCCCTTGCTATGGTTATCAGGACATC

ACTGAATAATGAGGAGCTG AAAATGCATGTCTTCAGGAAGACCTTGCAGGCATTGATCTACCCCATTTCTTCCACCACTCCCCACAACTTCGAGGTCTG

GACGGCTACCACACCCACCTACTGCTATGAATGTGAAGGGCTCCTGTGGGGCATCGCAAGGCAAGGCATGAAGTGTCTGGAGTGTGGGGTGAAATGCCAC

GAGAAGTGTCAGGACCTGCTCAACGCCGACTGTCTGCAGC GAGCAGCAGAGAAGAGCTCTAAGCACGGTGCGGAGGACAAGACCCAGACTATCATCACA

GCCATGAAAGAAAGAATGAAGATCAGGGAGAGAAACAGACCAGAGGTGTTTGAAGTCATTCAGGAAATGTTCCAGATCTCCAAAGAGGATTTTGTGCAGT

ACACAAAGGCTGCCAAGCAGAGCGTGCTGGATGGGACGTCGAAGTGGTCTGCAAAAATTACCATTACAG TGGTTTCCGCACAAGGCTTGCAGGCAAAAG

ACAAAACAGGGTCCAGCGACCCATATGTGACAGTTCAAGTTGGCAAAAATAAAAGAAGAACGAAAACTATCTTTGGAAACTTGAATCCAGTGTGGGACGA

GAAGTTCTTCTT TGAGTGTCATAACTCGACAGATCGAATCAAGGTCAGAGTATGGGATGAAGATGATGACATTAAATCCAGAGTTAAGCAGCACTTCAA

GAAGGAGTCGGATGACTTTCTGGGACAGACGATTGTGGAAGTCAGGACTCTAAGTGGTGAGATGGATGTCTGGTACAACTTAG AGAAACGGACAGATAA

GTCAGCTGTGTCTGGGGCCATCCGACTAAAAATCAATGTGGAGATAAAGGGAGAAGAGAAGGTCGCACCATACCATATACAATACACTTGTTTACACGAG

 AACCTGTTCCATTACCTGACGGAAGTGAAGTCTAATGGCAGTGTAAAAATACCAGAGGTCAAGGGCGATGAAGCCTGGAAGGTTTTCTTTGATGATGCG

TCTCAGGAAATAGTGGATGAATTTGCCATGCGTTATGGGGTTGAGTCCATTTATCAAGCTATGAC GCACTTTTCATGTCTGTCTTCTAAGTACATGTGC

CCGGGTGTCCCTGCAGTCATGAGCGCCCTGCTGGCGAACATCAATGCCTTCTATGCTCATACAACTGTCTCCACTAACGTGCAGGTTTCTGCCTCTGATC

GCTTTGCTGCTACAAACTTTGGG AGGGAAAAATTCATAAAACTACTGGACCAGTTGCATAACTCCTTAAGGATTGACCTGTCAAAGTACAGG GAAAAC

TTTCCAGCCAGCAACAGTGAGAGACTACAGGACCTAAAGTCCACTGTGGACCTGTTGACCAGCATCACCTTCTTCCGGATGAAG GTCCTGGAGCTGCAG

AGCCCCCCAAAGGCCAGTGCAGTTGTGAAGGACTGTGTCAGGGCTTGTCTGGATTCCACATACAAGTATATCTTCGACAACTGCCATGAACTCTATTCTC

AGCTGATAGACCCG AGCAAGAAGCAGGATGTCCCTCGAGAAGACCAGGGACCAACCACCAAGAACCTGGACTTCTGGCCACAGTTGATTACACTGATGG

TCACTATTATTGATGAGGATAAAACTGCCTACACCCCTGTTCTCAATCA - UNI35484 - GTTTCCACAAGAACTAAACATGGGGAAGATAAGTGCA

GAAATCATGTGGTCTCTTTTTGCTCTCGATATGAAATATGCTCTAGAGG - UNI35484 - AACATGAGAAGCAACGCTTATGCAAGAGCACCGATTA

TATGAATTTGCATTTCAAAGTGAAATGGTTTTATAATGAGTATGTACGAGAACTTCCTGCCTTCAAGGATGCTGTTCCAGAATATTCCCT - UNI3548

4 - GTGGTTTGAGCCTTTTGTTATGCAATGGCTAGATGAAAATGAAGATGTGTCCATGGAGTTCCTTCATGGAGCACTGGGAAGAGACAAAAAAGATGG

A TTCCAGCAGACATCGGACCACGCCCTTTTCTCCTGTTCTGTGGTTGATGTCTTTGCTCAGCTTAACCAGAGCTTTGAGATCATTAAGAAACTGGAATG

CCCCAATCCTGAAGCCCTATCACACTTAATGAGACGATTTGCAAAG ACCATCAATAAGGTTCTGGTCCAGTACGCTGCGATCGTATCAAATGACTTCAG

TTCATACTGCGATAAGGAGACAGTG CCTTGCATATTGATGAACAACATCCAACAACTGCGGGTCCAGCTGGAAAAAATGTTTGAATCCATGGGTGGGAA

AGAG CTAGACCCTGAAGCTAGCACTATTCTGAAAGAACTTCAAATCAAACTCAACGGGGTTCTGGATGCACTCAGCATCACTTATGGAGAAAG TTTCC

AACTTACAATTGAAGAGTGTATAAAGCAGATGGGTGCCGAGCTGAATCAGATGCGAGCCAACGGGAACAGCACAGCGAATAAGAACAGTGCGGCGATGGA

TGCAGAGATTGTGCTGAGGCCGCTCATGGACTTCTTGGATAAGAC ATTAAGTCTTTCAGCAAAAATTTGTGAGAAAACGGTCCTGAAGCGAGTTCTGAA

GGAGCTCTGGAAATTAGTACTTAACAAGATAGAGAAGCAGATTGTTCTCCCTCCACTGACAGACCAAACG GGGCCTCAGATGATCTTCATTGCTGCTAA

AGATCTTGGACAGTTATCCAAACTGAAG GAGCATATGATTCGAGAAGATGCCAAGGGTCTGACACCAAGACAATGTGCAATAGTGGAGGTGGTCTTGGC

CACTATAAAG CAATATTTTCATGCAGGAGGAAATGGCCTGAAGAAGAATTTTCTGGAGAAAAGCCCAGATCTTCATTCCCTGAGATACGCTCTCAGCCT

CTACACACAAACTACTGATGCTTTGATCAAGAAGTTCATAGAGACACAGGGCTCACAGA GTCGTTCCTCCAAAGATGCTGTAGGCCAGATCTCTGTCCA

TGTGGATGTCACCACCACCCCAGGGACTGGAGACCATAAAGTCACTGTGAAAG TAATTGCGATCAATGACCTAAACTGGCAGACCACCGCCATGTTCCG

CCCCTTTGTGGAAGTGTGCATGCTGGGACCCAGCCTAGGGGACAAGAAGAGAAAACAAGGGACAAAGACAAAAAGCAACACATGGTCACCGAAGTACAAT

GAAACCTTCCAGTT CATTCTGGGTAACGAGAACCGCCCAGGAGCCTATGAACTTCACCTCTCGGTTAAGGACTACTGCTTTGCCCGAGAAGATCGAATA

ATTGGAATGACAGTCATTCAGTTACAGAACATAGCAGAGAAAGGGAGCTACGGGGCATGGTACCCTCTTCTGAAAAATCTCTCTATGGATGAAACTGGTT

TAACCATCCTCAGAATACTCTCTCAGAGGACCAGCGACGATGTCGCTAAAGAGTTTGTGAGACTTAAGTCAGAAACGAGGTCTATTGAAGAGAGTGCCTG

AAACAAAGACTTCCAAATACTGTCTTTGAGAATTCATAAACTCTTGTTGTTTGACCCTCACATGCATGTGGAAATACATGGGAATGTTTAAACCCACCGT

GTTTTGATGTTTGCCAGTGATCAACCACAGTGTCTACAACGTATGTGAAAAACTTTTATACCAGTCTGGTCTTTGAGAAATAAATGTTCCATGAAGTGCC

AAAATATGATGTAAAGTGAAATATCAAGGCTATCTTTTACAATGTTCTTCTCATTACCAATTTCTCCTCCATGAAGAAAACAAAAAAAAAAAAAAAAACA

AACAAAAAAACCAAAACAAACAAACATTCTTGAGTTTGTCCATTGGTTGTCCTTGTTAGATTCATTTGATCAACCTATCCGAAAGCATCTTTGACTGAAC

TTCTGTTCTGTTTAGCCTTACCTTATTGTAGACACCCTGCAGATCCAGTTTTCTACCACACCTAGAAATGCAGCGACTTCTAGAAAGTTTGTAATTTTAT

AGTTGCAGATATATTGTGATGATTTTTGCATACAAATTACAATAGAAAAGGTGGGAAATATTTTATGCTGACCAGTTCCTAACCTTTCTAAAATATCACT

GTGAAGAAATGCTTTCGAAGCAAACTTACACAAAGCAATGCTAAATAGTTTGTTAATGTTTAATATATTGATGAAACTGTGTTCTTTAAAACTGCCAAGC

CCCCAACCATCACATTTGTAATTTAAAAAAAAAAAGAAAAAAAATGGTAACCTGATGAGTTTGCTGTGTAGCATTATGTCTCAGCTTTACCCTACTTCAT

TCTTTGGAAAGTCATGGAATGCAAGATAAGTAACTTGTTAGAAGGAAAATACTAACAATATACTTATGACTACTTAACTCTACATCCAGATGTCTCTTTT

AAAAATATTCAATGGTTTATGCTGAATGCAGCACTACTGTAGATTGCAGAAAACCAAAGTCACAACTTCGTATATATTTAGGAGGGAAAAATGTAAAATA

AACTAAAAGTAAATGGCTCATGATTTTGTAACTCGTGTTCTTTATATGCCCCAAATGCAACTTGGTTACAGATACTTGCGTTGTCTGGATTTTGTTATCT

GACTTTCCAGGGTCTGTATTTAAATATTTGGCTGCAAAGCATCATTTTGTCATTGTAACTCACAGCCACGGCTGTGAGGAGATTCCCCACTTGGCCAGGA

TTGAGAAGCTGTCCTGTTGACTGTGTTATATAAACATGCTGGTCTAATATGTGAGGAGCAGAAGTGATTTAGTGCCATCTCTCTCAACCATTCTGCTTCT

GGGTCTGAAAACACACAAGCTGGTGAGATTGGCTAATTTGTGTTCAAATCTTAGGCGACTGCTTTGTTAATGACTTTTCTAAATGCCTAGTATGACGCAA

TTGCTGACATATGCATTAATAAATGGATGTGTATTGAACTCATGCAAAA
Translation
                - UNI35484 -  - UNI35484 -  - UNI35484 -      MDFLDKT TLSLSAKICEKTVLKRVLKELWKLVLNKIE

KQIVLPPLTDQT GPQMIFIAAKDLGQLSKLK EHMIREDAKGLTPRQCAIVEVVLATIK QYFHAGGNGLKKNFLEKSPDLHSLRYALSLYTQTTDALI

KKFIETQGSQS SRSSKDAVGQISVHVDVTTTPGTGDHKVTVKV VIAINDLNWQTTAMFRPFVEVCMLGPSLGDKKRKQGTKTKSNTWSPKYNETFQF 

FILGNENRPGAYELHLSVKDYCFAREDRIIGMTVIQLQNIAEKGSYGAWYPLLKNLSMDETGLTILRILSQRTSDDVAKEFVRLKSETRSIEESA
Transcript ENSMUST00000075245
Sequence
ATGGTGGCCAGTCTCTTTAAGAGCTTGATTTTAGCTTATATACATAAGCTTTGCAAAGGAATGTTTACAAAGAAATTGGGAAATACAACCAAAAAGAAAG

AGAATCGTCAGCAGAAAAAAGATCAAGATTTTCCAACTGCTGGCCACACCAAACCCCCTAAATTGTCAAATGCCCTGAAAAGCACTGTAAAAAAGATTGC

AAAGTGCTCATCTACCCGGAACTTCTCCATAGAAGACGAAGAGGGTCACAAAGACTTCTCCCTGTCACCCACATTCAGTTACCGAGTTGCTATCGCCAAT

GGCCTGCAAACAGCCGTGACCAACAGCGATGAGGATCTGCTCCAGGAGCTGTCTTCCATCGAGAGCTCGTACTCTGAATCCTTCAATGAGCTAAGGAGCA

GCACGGAAAACCAGGTCCAATCAACACACACCATGCCTGTCCGACGTAACAGGAAGAGCTCGAGCAGTTTGGCACCTTCTGAGGGCAGCTCAGATGGGGA

GCGCACCCTCCACACCTTAAAACTGGGTGCTCTACGGAAACTGAGGAAATGGAAGAAGAGCCAAGAGTGCGTCTCCTCAGACTCGGAGTTGAGCACCGTC

AAGAAAACCTGGGGCATAAGAAGCAAATCATTAGATAGAACTGCCCGGAACCCAAAGACAAATGTCTTAGAGCCAGGGTTCAGCTCCTCTGGCTGCATTA

GCCAAACCCACGATGTCATGGAAATGATCTTTAAAGAGCTTCAGGGTATAAGTCAGATCGAAACAGAACTTTCCGAACTCCGAGGGCACGTGAATGCTCT

CAAGTACTCTATCGATGAAATCTCCAGCAGTGTGGAGGTAGTCCAGAGCGAGATCGAACAGCTTCGAACAGGGTTTGTCCAGGCTCGAAGGGAAACTCGA

GACATCCACGATTACATTAAACACTTGGGTCACATGGGGAGTAAGGTAAGCCTGAGATTTTTAAATGTGCCTGAAGAAAGACACGAGTACGTGGAAAGTG

TGGTGTACCAAATTCTTATAGATAAAATGGGTTTCTCAGATGTACCGAATGCTATTAAAATTGAATTTGCTCAGAGGATAGGGCAGCAAAGGGACTGCCC

AAATGCAAAACCTCGACCCATCCTAGTGTACTTTGAAACCCCTCAGCAAAGGGATTCTGTCTTAAAGAAATCGTATAAGCTGAAAGGTACAGGCATCGGG

ATCTCCACAGATATTCTAACTTATGATATCAGAGAACGGAAAGAAAAAGGGGTATTGCCATCTTCCCAGACATACGAAAGCATGGATATGAAGTTATCCA

CGCCAGAGCCCAAAGCCAAGAAGAACGCTTGGCTGTCACCCAATGACAGTGACAGAGAGCTGGAGTCAGACCTCAGCAGAAGCAGCTATGCTGACTCTCC

GGCAAAGGGAAGTTCTTCTAAATCCAGCTCAAAGTCACACAGTGCTCGGTCCAAGAACAAAGCAGCTAACAGCAGAACATCACAGAAGTCAGACTACAAT

AAACGGCCCTCCCAACCGCCAGCATCAAGTACCCCAGAAAAGCAAACACCTCACTATGTGGAGGCCACACCACCACTCTGGCATTCACAGAGTGACTTCT

TCACTCTTAAACTTAGTCGCTCCGAATCGGATTTCTCCAAATTGTGTCAATCTTATTCAGAGGATTTTTCTGAAAGCCAGTTTTTCTGTCGAACTAATGG

GAGCTCCCTCCTTTCCTCGTCTGACCGGGAACTTTGGCAGAGGAAACAGGAGGGCATGCCTGCCTTGTACCACCGTCTTCAGGACCAGGGTTTGGATGAG

ACTATTCCAGCAGTGCCAGGGCAGGCTGAAATTGAGAATACAGAAACAGTAGACAGCGGTATGAGCAACAGCATGGTGTGTGCATCTGGAGACCGAAGCA

ATTACAGCGGTTCTCAGCTCTCATTGCACGAGGACCTGTCTCCATGGAAGGAGTGGAATCAAGCAGGGCAAGGAACTGATGATGTTGGCTTAGATTCATC

TACCCAGGAACCTTTTGACTACGATACCAACAGTTTGTCTGACCAACAGCTGGATCTCTCTAGCAAAGACCTAGATGACCTTGGCAAGTGCCACAGCGAC

CTGCAAGATGACTCTGAAAGCTATGATTTAACCCAGGATGACAACTCCTCTCCATGCCCTGGATTGGATAATGAACCACAAGGCCAGTGGGTTGGCCAGT

ACGACTCTTATCAGGAAGCCAATTCTAATGACCTGTATCCCAACCAAAGCCATCCATCCATGATGTATAGAAGTCAAAGCGAACTGCAAAGTGATGATTC

AGAGGGGGCCCAGCCCAAGTCCTGGCACAGTCGGCTAAGCATTGACCTTTCTGATAAGACTTTTAAGTTCCCCAAATTTGGATCTACTCTTCAGAGAGCA

AAGTCAGCCCTGGAAGTGGTGTGGAACAAGAGCACACAGAGTCTCAGTGGGTGTGAGGACAGCGGCTCTTCCTTAATGGGGAGATTTCGGACATTATCAC

AATCCACCGCGAACGAGTCAAGTACCACCCTTGACTCTGATATCTACACGGAACCCTATTACTATAAAGCCGAGGAAGAGGAGGACTACTGTGAACCAGT

GGCTGACAGTGAGACAGATTATGTTGAAGTGATGGAGCAGGTCCTAGCTAAGCTAGAAAACAGGACTAGTATCACTGAAGTAAACGAACACATTAAAGAC

TATGACCACCCTTCCTATGAAACTCCTTACGAGACCCCGCAAGATGAGGGCTATGATGGGCAGGCTGATGACATCATTAGTGAAGGAGAACTGGAAACCT

TAAATGAACCAGCAGTTGAAATGGAATTAGCAGAAGATGAGAACCAAAACCTCCCTGCAGAGTCACTGGAGGTCATGAAGCCAAAGAGAATCAGGCCTTC

CTTCAAAGAAGCAGCTTTAAGGGCCTATAAGAAGCAGATGGCAGAGCTGGAAGAGAAGATCCTGGCTGGAG ATAGCAGCTCTATGGATGAAAAG GCTC

GAATAGTAAGTGGCAATGATTTGGATGCTTCCAAATTCTCCGCACTCCAGGTGTTCGGTGG GGCTGGGCGTGGACTGTATGGTATTGATAGCATGCCTG

ACCTCCGCAGGAAAAAGACATTGCCTATTGTGCGGGATGTG GCCATG ACCCTGGCTGCCCGGAAATCTGGTCTCTCCCTTGCTATGGTTATCAGGACA

TCACTGAATAATGAGGAGCTG AAAATGCATGTCTTCAGGAAGACCTTGCAGGCATTGATCTACCCCATTTCTTCCACCACTCCCCACAACTTCGAGGTC

TGGACGGCTACCACACCCACCTACTGCTATGAATGTGAAGGGCTCCTGTGGGGCATCGCAAGGCAAGGCATGAAGTGTCTGGAGTGTGGGGTGAAATGCC

ACGAGAAGTGTCAGGACCTGCTCAACGCCGACTGTCTGCAGC GAGCAGCAGAGAAGAGCTCTAAGCACGGTGCGGAGGACAAGACCCAGACTATCATCA

CAGCCATGAAAGAAAGAATGAAGATCAGGGAGAGAAACAGACCAGAGGTGTTTGAAGTCATTCAGGAAATGTTCCAGATCTCCAAAGAGGATTTTGTGCA

GTACACAAAGGCTGCCAAGCAGAGCGTGCTGGATGGGACGTCGAAGTGGTCTGCAAAAATTACCATTACAG TGGTTTCCGCACAAGGCTTGCAGGCAAA

AGACAAAACAGGGTCCAGCGACCCATATGTGACAGTTCAAGTTGGCAAAAATAAAAGAAGAACGAAAACTATCTTTGGAAACTTGAATCCAGTGTGGGAC

GAGAAGTTCTTCTT TGAGTGTCATAACTCGACAGATCGAATCAAGGTCAGAGTATGGGATGAAGATGATGACATTAAATCCAGAGTTAAGCAGCACTTC

AAGAAGGAGTCGGATGACTTTCTGGGACAGACGATTGTGGAAGTCAGGACTCTAAGTGGTGAGATGGATGTCTGGTACAACTTAG AGAAACGGACAGAT

AAGTCAGCTGTGTCTGGGGCCATCCGACTAAAAATCAATGTGGAGATAAAGGGAGAAGAGAAGGTCGCACCATACCATATACAATACACTTGTTTACACG

AG AACCTGTTCCATTACCTGACGGAAGTGAAGTCTAATGGCAGTGTAAAAATACCAGAGGTCAAGGGCGATGAAGCCTGGAAGGTTTTCTTTGATGATG

CGTCTCAGGAAATAGTGGATGAATTTGCCATGCGTTATGGGGTTGAGTCCATTTATCAAGCTATGAC GCACTTTTCATGTCTGTCTTCTAAGTACATGT

GCCCGGGTGTCCCTGCAGTCATGAGCGCCCTGCTGGCGAACATCAATGCCTTCTATGCTCATACAACTGTCTCCACTAACGTGCAGGTTTCTGCCTCTGA

TCGCTTTGCTGCTACAAACTTTGGG AGGGAAAAATTCATAAAACTACTGGACCAGTTGCATAACTCCTTAAGGATTGACCTGTCAAAGTACAGG GAAA

ACTTTCCAGCCAGCAACAGTGAGAGACTACAGGACCTAAAGTCCACTGTGGACCTGTTGACCAGCATCACCTTCTTCCGGATGAAG GTCCTGGAGCTGC

AGAGCCCCCCAAAGGCCAGTGCAGTTGTGAAGGACTGTGTCAGGGCTTGTCTGGATTCCACATACAAGTATATCTTCGACAACTGCCATGAACTCTATTC

TCAGCTGATAGACCCG AGCAAGAAGCAGGATGTCCCTCGAGAAGACCAGGGACCAACCACCAAGAACCTGGACTTCTGGCCACAGTTGATTACACTGAT

GGTCACTATTATTGATGAGGATAAAACTGCCTACACCCCTGTTCTCAATCA - UNI35484 - GTTTCCACAAGAACTAAACATGGGGAAGATAAGTG

CAGAAATCATGTGGTCTCTTTTTGCTCTCGATATGAAATATGCTCTAGAGG - UNI35484 - AACATGAGAAGCAACGCTTATGCAAGAGCACCGAT

TATATGAATTTGCATTTCAAAGTGAAATGGTTTTATAATGAGTATGTACGAGAACTTCCTGCCTTCAAGGATGCTGTTCCAGAATATTCCCT - UNI35

484 - GTGGTTTGAGCCTTTTGTTATGCAATGGCTAGATGAAAATGAAGATGTGTCCATGGAGTTCCTTCATGGAGCACTGGGAAGAGACAAAAAAGAT

GGA TTCCAGCAGACATCGGACCACGCCCTTTTCTCCTGTTCTGTGGTTGATGTCTTTGCTCAGCTTAACCAGAGCTTTGAGATCATTAAGAAACTGGAA

TGCCCCAATCCTGAAGCCCTATCACACTTAATGAGACGATTTGCAAAG ACCATCAATAAGGTTCTGGTCCAGTACGCTGCGATCGTATCAAATGACTTC

AGTTCATACTGCGATAAGGAGACAGTG CCTTGCATATTGATGAACAACATCCAACAACTGCGGGTCCAGCTGGAAAAAATGTTTGAATCCATGGGTGGG

AAAGAG CTAGACCCTGAAGCTAGCACTATTCTGAAAGAACTTCAAATCAAACTCAACGGGGTTCTGGATGCACTCAGCATCACTTATGGAGAAAG TTT

CCAACTTACAATTGAAGAGTGTATAAAGCAGATGGGTGCCGAGCTGAATCAGATGCGAGCCAACGGGAACAGCACAGCGAATAAGAACAGTGCGGCGATG

GATGCAGAGATTGTGCTGAGGCCGCTCATGGACTTCTTGGATAAGAC ATTAAGTCTTTCAGCAAAAATTTGTGAGAAAACGGTCCTGAAGCGAGTTCTG

AAGGAGCTCTGGAAATTAGTACTTAACAAGATAGAGAAGCAGATTGTTCTCCCTCCACTGACAGACCAAACG GGGCCTCAGATGATCTTCATTGCTGCT

AAAGATCTTGGACAGTTATCCAAACTGAAG GAGCATATGATTCGAGAAGATGCCAAGGGTCTGACACCAAGACAATGTGCAATAGTGGAGGTGGTCTTG

GCCACTATAAAG CAATATTTTCATGCAGGAGGAAATGGCCTGAAGAAGAATTTTCTGGAGAAAAGCCCAGATCTTCATTCCCTGAGATACGCTCTCAGC

CTCTACACACAAACTACTGATGCTTTGATCAAGAAGTTCATAGAGACACAGGGCTCACAGA GTCGTTCCTCCAAAGATGCTGTAGGCCAGATCTCTGTC

CATGTGGATGTCACCACCACCCCAGGGACTGGAGACCATAAAGTCACTGTGAAAG TAATTGCGATCAATGACCTAAACTGGCAGACCACCGCCATGTTC

CGCCCCTTTGTGGAAGTGTGCATGCTGGGACCCAGCCTAGGGGACAAGAAGAGAAAACAAGGGACAAAGACAAAAAGCAACACATGGTCACCGAAGTACA

ATGAAACCTTCCAGTT CATTCTGGGTAACGAGAACCGCCCAGGAGCCTATGAACTTCACCTCTCGGTTAAGGACTACTGCTTTGCCCGAGAAGATCGAA

TAATTGGAATGACAGTCATTCAGTTACAGAACATAGCAGAGAAAGGGAGCTACGGGGCATGGTACCCTCTTCTGAAAAATCTCTCTATGGATGAAACTGG

TTTAACCATCCTCAGAATACTCTCTCAGAGGACCAGCGACGATGTCGCTAAAGAGTTTGTGAGACTTAAGTCAGAAACGAGGTCTATTGAAGAGAGTGCC

TGAAACAAAGACTTCCAAATACTGTCTTTGAGAATTCATAAACTCTTGTTGTTTGACCCTCACATGCATGTGGAAATACATGGGAATGTTTAAACCCACC

GTGTTTTGATGTTTGCCAGTGATCAACCACAGTGTCTACAACGTATGTGAAAAACTTTTATACCAGTCTGGTCTTTGAGAAATAAATGTTCCATGAAGTG

CCAAAATATGATGTAAAGTGAAATATCAAGGCTATCTTTTACAATGTTCTTCTCATTACCAATTTCTCCTCCATGAAGAAAACAAAAAAAAAAAAAAAAA

CAAACAAAAAAACCAAAACAAACAAACATTCTTGAGTTTGTCCATTGGTTGTCCTTGTTAGATTCATTTGATCAACCTATCCGAAAGCATCTTTGACTGA

ACTTCTGTTCTGTTTAGCCTTACCTTATTGTAGACACCCTGCAGATCCAGTTTTCTACCACACCTAGAAATGCAGCGACTTCTAGAAAGTTTGTAATTTT

ATAGTTGCAGATATATTGTGATGATTTTTGCATACAAATTACAATAGAAAAGGTGGGAAATATTTTATGCTGACCAGTTCCTAACCTTTCTAAAATATCA

CTGTGAAGAAATGCTTTCGAAGCAAACTTACACAAAGCAATGCTAAATAGTTTGTTAATGTTTAATATATTGATGAAACTGTGTTCTTTAAAACTGCCAA

GCCCCCAACCATCACATTTGTAATTTAAAAAAAAAAAGAAAAAAAATGGTAACCTGATGAGTTTGCTGTGTAGCATTATGTCTCAGCTTTACCCTACTTC

ATTCTTTGGAAAGTCATGGAATGCAAGATAAGTAACTTGTTAGAAGGAAAATACTAACAATATACTTATGACTACTTAACTCTACATCCAGATGTCTCTT

TTAAAAATATTCAATGGTTTATGCTGAATGCAGCACTACTGTAGATTGCAGAAAACCAAAGTCACAACTTCGTATATATTTAGGAGGGAAAAATGTAAAA

TAAACTAAAAGTAAATGGCTCATGATTTTGTAACTCGTGTTCTTTATATGCCCCAAATGCAACTTGGTTACAGATACTTGCGTTGTCTGGATTTTGTTAT

CTGACTTTCCAGGGTCTGTATTTAAATATTTGGCTGCAAAGCATCATTTTGTCATTGTAACTCACAGCCACGGCTGTGAGGAGATTCCCCACTTGGCCAG

GATTGAGAAGCTGTCCTGTTGACTGTGTTATATAAACATGCTGGTCTAATATGTGAGGAGCAGAAGTGATTTAGTGCCATCTCTCTCAACCATTCTGCTT

CTGGGTCTGAAAACACACAAGCTGGTGAGATTGGCTAATTTGTGTTCAAATCTTAGGCGACTGCTTTGTTAATGACTTTTCTAAATGCCTAGTATGACGC

AATTGCTGACATATGCATTAATAAATGGATGTGTATTGAACTCATGCAAAA
Translation
MVASLFKSLILAYIHKLCKGMFTKKLGNTTKKKENRQQKKDQDFPTAGHTKPPKLSNALKSTVKKIAKCSSTRNFSIEDEEGHKDFSLSPTFSYRVAIAN

GLQTAVTNSDEDLLQELSSIESSYSESFNELRSSTENQVQSTHTMPVRRNRKSSSSLAPSEGSSDGERTLHTLKLGALRKLRKWKKSQECVSSDSELSTV

KKTWGIRSKSLDRTARNPKTNVLEPGFSSSGCISQTHDVMEMIFKELQGISQIETELSELRGHVNALKYSIDEISSSVEVVQSEIEQLRTGFVQARRETR

DIHDYIKHLGHMGSKVSLRFLNVPEERHEYVESVVYQILIDKMGFSDVPNAIKIEFAQRIGQQRDCPNAKPRPILVYFETPQQRDSVLKKSYKLKGTGIG

ISTDILTYDIRERKEKGVLPSSQTYESMDMKLSTPEPKAKKNAWLSPNDSDRELESDLSRSSYADSPAKGSSSKSSSKSHSARSKNKAANSRTSQKSDYN

KRPSQPPASSTPEKQTPHYVEATPPLWHSQSDFFTLKLSRSESDFSKLCQSYSEDFSESQFFCRTNGSSLLSSSDRELWQRKQEGMPALYHRLQDQGLDE

TIPAVPGQAEIENTETVDSGMSNSMVCASGDRSNYSGSQLSLHEDLSPWKEWNQAGQGTDDVGLDSSTQEPFDYDTNSLSDQQLDLSSKDLDDLGKCHSD

LQDDSESYDLTQDDNSSPCPGLDNEPQGQWVGQYDSYQEANSNDLYPNQSHPSMMYRSQSELQSDDSEGAQPKSWHSRLSIDLSDKTFKFPKFGSTLQRA

KSALEVVWNKSTQSLSGCEDSGSSLMGRFRTLSQSTANESSTTLDSDIYTEPYYYKAEEEEDYCEPVADSETDYVEVMEQVLAKLENRTSITEVNEHIKD

YDHPSYETPYETPQDEGYDGQADDIISEGELETLNEPAVEMELAEDENQNLPAESLEVMKPKRIRPSFKEAALRAYKKQMAELEEKILAGD DSSSMDEK

 ARIVSGNDLDASKFSALQVFGG GAGRGLYGIDSMPDLRRKKTLPIVRDV AM TLAARKSGLSLAMVIRTSLNNEEL KMHVFRKTLQALIYPISSTT

PHNFEVWTATTPTYCYECEGLLWGIARQGMKCLECGVKCHEKCQDLLNADCLQR RAAEKSSKHGAEDKTQTIITAMKERMKIRERNRPEVFEVIQEMFQ

ISKEDFVQYTKAAKQSVLDGTSKWSAKITITV VVSAQGLQAKDKTGSSDPYVTVQVGKNKRRTKTIFGNLNPVWDEKFFF FECHNSTDRIKVRVWDED

DDIKSRVKQHFKKESDDFLGQTIVEVRTLSGEMDVWYNLE EKRTDKSAVSGAIRLKINVEIKGEEKVAPYHIQYTCLHE NLFHYLTEVKSNGSVKIPE

VKGDEAWKVFFDDASQEIVDEFAMRYGVESIYQAMT THFSCLSSKYMCPGVPAVMSALLANINAFYAHTTVSTNVQVSASDRFAATNFG REKFIKLLD

QLHNSLRIDLSKYR ENFPASNSERLQDLKSTVDLLTSITFFRMK VLELQSPPKASAVVKDCVRACLDSTYKYIFDNCHELYSQLIDP SKKQDVPRED

QGPTTKNLDFWPQLITLMVTIIDEDKTAYTPVLNQ - UNI35484 - QFPQELNMGKISAEIMWSLFALDMKYALEE - UNI35484 - EHEKQRL

CKSTDYMNLHFKVKWFYNEYVRELPAFKDAVPEYSL - UNI35484 - LWFEPFVMQWLDENEDVSMEFLHGALGRDKKDG FQQTSDHALFSCSVVD

VFAQLNQSFEIIKKLECPNPEALSHLMRRFAK TINKVLVQYAAIVSNDFSSYCDKETV PCILMNNIQQLRVQLEKMFESMGGKE LDPEASTILKELQ

IKLNGVLDALSITYGES SFQLTIEECIKQMGAELNQMRANGNSTANKNSAAMDAEIVLRPLMDFLDKT TLSLSAKICEKTVLKRVLKELWKLVLNKIE

KQIVLPPLTDQT GPQMIFIAAKDLGQLSKLK EHMIREDAKGLTPRQCAIVEVVLATIK QYFHAGGNGLKKNFLEKSPDLHSLRYALSLYTQTTDALI

KKFIETQGSQS SRSSKDAVGQISVHVDVTTTPGTGDHKVTVKV VIAINDLNWQTTAMFRPFVEVCMLGPSLGDKKRKQGTKTKSNTWSPKYNETFQF 

FILGNENRPGAYELHLSVKDYCFAREDRIIGMTVIQLQNIAEKGSYGAWYPLLKNLSMDETGLTILRILSQRTSDDVAKEFVRLKSETRSIEESA

For any suggestions or comments, please send an email to unitrap@crg.es