Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000062300 (Pvrl2)
Chromosomal location
Chr 7: 20302015 - 20334818 (-)
Description
poliovirus receptor-related 2 Gene [Source:MGI Symbol;Acc:MGI:97822]
RefSeq_dna
NM_008990 
RefSeq_peptide
NP_033016.2 
UniGene
Mm.4341 
MGI
MGI:97822 
Uniprot/SWISSPROT
P32507 
Uniprot/SPTREMBL
Q3TZU9 Q8C6F2 Q91VT9 Q80XJ5 
Human Ortholog
ENSG00000130202 (PVRL2)
Omim not available
UniTrap UNI10803
Vector Insertion
Chr 7: 20323724 - 20334563
Public Clones (sanger) P030D01 (ggtc) E115D11 (ggtc) P104H12 (ggtc) E047G05 (ggtc)
D037F07 (ggtc) E324G12 (ggtc) D127F12 (ggtc) W168F02 (ggtc) E326D01 (ggtc)
M125F01 (ggtc) E324A06 (ggtc) E055G08 (ggtc) D010E07 (ggtc) E033A08 (ggtc)
CMHD-GT_545H11-5S (cmhd) CMHD-GT_545H11-3 (cmhd) PST22203-NR (escells)
IST14521A3 (tigm) IST11504H12 (tigm) IST14631C10 (tigm) IST14317D3 (tigm)
IST12517A6 (tigm) IST13543A11 (tigm) IST10619E10 (tigm) IST10984B5 (tigm)
IST14651D4 (tigm)
Private Clones OST464511 (lexicon) OST446125 (lexicon) OST440677 (lexicon) OST428417 (lexicon)
OST412673 (lexicon) OST368453 (lexicon) OST324914 (lexicon) OST268341 (lexicon)
OST249693 (lexicon) OST240460 (lexicon) OST232398 (lexicon) OST226294 (lexicon)
OST222023 (lexicon) OST209433 (lexicon) OST207350 (lexicon) OST198483 (lexicon)
OST192623 (lexicon) OST187404 (lexicon) OST185619 (lexicon) OST169899 (lexicon)
OST169309 (lexicon) OST154756 (lexicon) OST65642 (lexicon)
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI11398
Vector Insertion
Chr 7: 20318561 - 20323360
Public Clones G002C04 (ggtc)
Private Clones OST451358 (lexicon)
Severity of mutation (?) Insertion after 32% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9488
Vector Insertion
Chr 7: 20315536 - 20315960
Public Clones XST033 (baygenomics) RST387 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 62% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI9814
Vector Insertion
Chr 7: 20310219 - 20315386
Public Clones LST076 (baygenomics) PST093 (baygenomics) XST131 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 73% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI8949
Vector Insertion
Chr 7: 20304846 - 20306701
Public Clones RRE206 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33285
Vector Insertion
Chr 7: 20302014 - 20304632
Public Clones PST22881-NR (escells) IST14170E2 (tigm) IST12320G4 (tigm) IST12823F5 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000108450
Sequence
GGCGAGGGAAAGCTGGGCCGAACGAACTGATCCGGGGAGCCGTGAGCGGCGGAAGCCGGCCTGGAGCCGGACACTTCAGACCCCTGACTGCCCTCCCAGC

CGATCGGTACACGAAGAGTGGTCCCTAGGCACCCCCTGCCCGGGCCCAGTCCCTCCCCGGGCCCCCCATGGCCCGGGCCGCAGTCCTCCCGCCGTCCAGA

TTGTCACCGACGCTGCCGTTGTTGCCGCTGCTACTGCTCCTGCTTCAGGAAACAG - UNI10803 - GAGCCCAAGATGTGCGGGTACGAGTGCTTCC

CGAGGTCCGGGGCCGCTTGGGAGGCACCGTGGAGTTACCGTGCCACCTGCTCCCACCCACGACGGAGCGCGTCTCTCAGGTGACCTGGCAGCGCCTGGAT

GGCACAGTTGTGGCTGCTTTCCACCCATCCTTCGGAGTGGATTTCCCCAACTCTCAGTTCAGCAAGGACCGTCTGTCCTTTGTCAGAGCGAGACCAGAAA

CAAACGCAGACCTGCGGGATGCCACACTGGCCTTCCGGGGACTGAGGGTAGAGGACGAGGGCAATTACACCTGCGAGTTTGCCACGTTTCCCAACGGTAC

CCGCAGGGGGGTGACCTGGCTCAGAGTCATAG - UNI11398 - CCCAGCCTGAGAACCACGCTGAAGCCCAGGAGGTCACAATTGGCCCCCAGTCGG

TGGCTGTAGCCCGCTGTGTCTCCACTGGGGGCCGCCCCCCTGCCCGAATCACCTGGATCTCATCTCTGGGTGGAGAGGCCAAAGATACTCAGGAGCCAGG

GATACAGGCTGGCACCGTCACTATCATCAGCCGATACTCCTTGGTGCCCGTGGGCCGAGCGGATGGCGTCAAGGTCACGTGTAGAGTGGAACACGAGAGC

TTCGAAGAGCCGATCCTGCTGCCAGTGACCCTCTCTGTGCGCT ACCCTCCAGAAGTATCCATCTCCGGCTATGATGACAACTGGTACCTTGGCCGCAGT

GAGGCCATACTGACCTGTGATGTACGAAGCAACCCAGAGCCCACAGACTATGACTGGAGCAC - UNI9488 - GACCTCGGGCGTCTTCCCAGCCTCT

GCAGTGGCCCAGGGCTCTCAGCTGCTTGTCCACTCTGTGGATCGAATGGTCAACACTACCTTCATCTGTACAGCCACCAACGCTGTGGGGACAGGCCGTG

CTGAGCAGGTCATCCTGGTGCGAG - UNI9814 - ACACCCCCCAGGCCTCCCGAGATGTGGGTCCGCTGGTGTGGGGGGCCGTGGGGGGAACATTGC

TGGTGCTACTCCTGGCTGGGGGGTTCCTGGCCTTGATCCTGCTGAGGGGGAGGAGGAGGCGGAAGAGCCCTGGAGGAGGAGGAAATGATGGCGACAGAGG

ATCCTACGATCCAAAGACTCAGGTGTTTGGGAACGGGGGTCCTGTCTTCTGGAGGTCAGCATCCCCTGAGCCCATGAGGCCAGATGGCAGGGAGGAAGAT

GAGGAGGAGGAGGAAGAAATGAAGGCAGAGGAAGGTCTCATGCTACCTCCACACGAGTCACCTAAGGACGACATGGAGTCCCATCTGGATGGCTCCCTCA

TCTCTCGGCGGGCAGTTTACGTGTGA
Translation
MARAAVLPPSRLSPTLPLLPLLLLLLQETG - UNI10803 - GAQDVRVRVLPEVRGRLGGTVELPCHLLPPTTERVSQVTWQRLDGTVVAAFHPSFG

VDFPNSQFSKDRLSFVRARPETNADLRDATLAFRGLRVEDEGNYTCEFATFPNGTRRGVTWLRVIA - UNI11398 - AQPENHAEAQEVTIGPQSVA

VARCVSTGGRPPARITWISSLGGEAKDTQEPGIQAGTVTIISRYSLVPVGRADGVKVTCRVEHESFEEPILLPVTLSVRY YPPEVSISGYDDNWYLGRS

EAILTCDVRSNPEPTDYDWST - UNI9488 - TTSGVFPASAVAQGSQLLVHSVDRMVNTTFICTATNAVGTGRAEQVILVRD - UNI9814 - DT

PQASRDVGPLVWGAVGGTLLVLLLAGGFLALILLRGRRRRKSPGGGGNDGDRGSYDPKTQVFGNGGPVFWRSASPEPMRPDGREEDEEEEEEMKAEEGLM

LPPHESPKDDMESHLDGSLISRRAVYV
Transcript ENSMUST00000075447
Sequence
GGCGAGGGAAAGCTGGGCCGAACGAACTGATCCGGGGAGCCGTGAGCGGCGGAAGCCGGCCTGGAGCCGGACACTTCAGACCCCTGACTGCCCTCCCAGC

CGATCGGTACACGAAGAGTGGTCCCTAGGCACCCCCTGCCCGGGCCCAGTCCCTCCCCGGGCCCCCCATGGCCCGGGCCGCAGTCCTCCCGCCGTCCAGA

TTGTCACCGACGCTGCCGTTGTTGCCGCTGCTACTGCTCCTGCTTCAGGAAACAG - UNI10803 - GAGCCCAAGATGTGCGGGTACGAGTGCTTCC

CGAGGTCCGGGGCCGCTTGGGAGGCACCGTGGAGTTACCGTGCCACCTGCTCCCACCCACGACGGAGCGCGTCTCTCAGGTGACCTGGCAGCGCCTGGAT

GGCACAGTTGTGGCTGCTTTCCACCCATCCTTCGGAGTGGATTTCCCCAACTCTCAGTTCAGCAAGGACCGTCTGTCCTTTGTCAGAGCGAGACCAGAAA

CAAACGCAGACCTGCGGGATGCCACACTGGCCTTCCGGGGACTGAGGGTAGAGGACGAGGGCAATTACACCTGCGAGTTTGCCACGTTTCCCAACGGTAC

CCGCAGGGGGGTGACCTGGCTCAGAGTCATAG - UNI11398 - CCCAGCCTGAGAACCACGCTGAAGCCCAGGAGGTCACAATTGGCCCCCAGTCGG

TGGCTGTAGCCCGCTGTGTCTCCACTGGGGGCCGCCCCCCTGCCCGAATCACCTGGATCTCATCTCTGGGTGGAGAGGCCAAAGATACTCAGGAGCCAGG

GATACAGGCTGGCACCGTCACTATCATCAGCCGATACTCCTTGGTGCCCGTGGGCCGAGCGGATGGCGTCAAGGTCACGTGTAGAGTGGAACACGAGAGC

TTCGAAGAGCCGATCCTGCTGCCAGTGACCCTCTCTGTGCGCT ACCCTCCAGAAGTATCCATCTCCGGCTATGATGACAACTGGTACCTTGGCCGCAGT

GAGGCCATACTGACCTGTGATGTACGAAGCAACCCAGAGCCCACAGACTATGACTGGAGCAC - UNI9488 - GACCTCGGGCGTCTTCCCAGCCTCT

GCAGTGGCCCAGGGCTCTCAGCTGCTTGTCCACTCTGTGGATCGAATGGTCAACACTACCTTCATCTGTACAGCCACCAACGCTGTGGGGACAGGCCGTG

CTGAGCAGGTCATCCTGGTGCGAG - UNI9814 - AGTCACCCAGCACAGCAGGAGCAGGGGCCACTGGTGGCATCATTGGAGGTATTATCGCTGCCA

TCATCGCCACCGCAGTGGCTGGCACAGGCATCCTCATCTGCCGACAACAGCGGAAGGAGCAGAGGCTTCAAGCTGCGGATGAGGAAGAAGA - UNI894

9 - ACTGGAAGGACCTCCCTCCTATAAACCACCCACCCCGAAGGCCAAGCTGGAGGAACCAGAGATG - UNI33285 - CCCTCTCAACTCTTCACC

TTGGGGGCCTCAGAGCACAGCCCAGTGAAGACGCCATACTTTGATGCTGGTGTCTCTTGTGCTGATCAG - UNI33285 - GAGATGCCTCGGTATCA

CGAGCTGCCCACTCTGGAAGAGCGGTCAGGGCCCCTGCTGTTGGGGGCTACAGGCCTGGGACCTTCTCTTCTGGTGCCTCCAGGACCCAATGTTGTGGAG

GGGGTTTCCCTGAGTCTCGAAGATGAGGAGGAAGATGATGAGGAGGAAGACTTCCTGGATAAAATCAACCCTATTTATGATGCCCTGTCCTACCCCAGCC

CCTCTGACTCCTACCAGAGCAAAGACTTTTTTGTGTCACGGGCCATGTATGTGTGAGGGAGGCACAGGGGCTCTGACGTCTCACCTTTCACCCTTGACCC

ATGAGCTTTCCACCAGTAATCTAGGACACTCTGACTTCCAGGCAGACCAGGGACAACTATCACCCATTGCAATCCACCTGTGACTTCTTAGTGACTCCAC

CATGACGTCCAATCTATGATGTCTGAGGCAGGCAAACCTGCACAACTGGAAACCTGGAGATTTTTATCTCCCTTGGCAGGGAGCTCACCATATCCTTCTG

CACCACCTGTGACCCCCCCCCCCCCCCCAAGGACTCCTAAGACTACGACCCTTTGACCATGCCACTCAGTATCTCAAGAACCCTTAAAGTCCCAAAGGAA

TCGGACCTTGCACTTGTCCTCAGGCAATAGAGTCCAACAGATATGCAAGAACGGGATCAGGGGCTCCCTGTTGCTCAGACCTGAGCCCTCCAGGCAGCAG

AAGCTCACCTGATCCCTCCCCACCCTGCTCCCCAAAGGTGAAAAGGAGAGGATTCCCCAATGTAAGGTAGGACCTCCCCATCTCCACCTACTCCTGCAGG

CAGGAATCTCAGGTTTCTCACACCCTCTCCTCAGCACCCAGGTTCCTGTCTCCAGAGCATGAATTCCAGGTCCAATGCTAGAGGGGAGAACCTAATGCAA

GTGTGCCTTGCCACCCCAAGTTTGGGAGACTCTGCTCTTATCCTGAGGACTACTGAATTCTTTTAACCCCTACCCAGTGAGATGAGAACTACATATCCCT

CTTTAGGGGATGGTGTGTGTATGTGTGTGTGATGGAGAATCTGGGCATCTGGGTTGGGAATTTTATTTTGTAAGCATTTCCTACATAATATGAGTTTCTA

CTTTG
Translation
MARAAVLPPSRLSPTLPLLPLLLLLLQETG - UNI10803 - GAQDVRVRVLPEVRGRLGGTVELPCHLLPPTTERVSQVTWQRLDGTVVAAFHPSFG

VDFPNSQFSKDRLSFVRARPETNADLRDATLAFRGLRVEDEGNYTCEFATFPNGTRRGVTWLRVIA - UNI11398 - AQPENHAEAQEVTIGPQSVA

VARCVSTGGRPPARITWISSLGGEAKDTQEPGIQAGTVTIISRYSLVPVGRADGVKVTCRVEHESFEEPILLPVTLSVRY YPPEVSISGYDDNWYLGRS

EAILTCDVRSNPEPTDYDWST - UNI9488 - TTSGVFPASAVAQGSQLLVHSVDRMVNTTFICTATNAVGTGRAEQVILVRE - UNI9814 - ES

PSTAGAGATGGIIGGIIAAIIATAVAGTGILICRQQRKEQRLQAADEEEE - UNI8949 - ELEGPPSYKPPTPKAKLEEPEM - UNI33285 - P

SQLFTLGASEHSPVKTPYFDAGVSCADQ - UNI33285 - EMPRYHELPTLEERSGPLLLGATGLGPSLLVPPGPNVVEGVSLSLEDEEEDDEEEDFL

DKINPIYDALSYPSPSDSYQSKDFFVSRAMYV

For any suggestions or comments, please send an email to unitrap@crg.es