Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000062342 (Serpinb9e)
Chromosomal location
Chr 13: 33341477 - 33352713 (+)
Description
serine (or cysteine) peptidase inhibitor, clade B, member 9e Gene [Source:MGI (curated);Acc:Serpinb9e-001]
RefSeq_dna
NM_011456 
RefSeq_peptide
NP_035586.1 
UniGene
Mm.379809 Mm.393577 
MGI
MGI:894672 
Uniprot/SPTREMBL
O08806 Q80Y29 
Human Ortholog
ENSG00000170542 (SERPINB9)
Omim not available
UniTrap UNI31105
Vector Insertion
Chr 13: 33341542 - 33343444
Public Clones IST12291G12 (tigm) IST14391H2 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 0% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000071873
Sequence
AACCACAGAGCACTCCAGGGTCAGAGACCATTGAACACTGCACCGTGAGATCAGAAATATTGGAG - UNI31103 - ACACTGCATCATGAATACTCT

GTCTCAAGCCAATGGCACCTTTGCCATCCATCTTTTGAAGGTGCTCTGTCAAGACAACCCTTCAGAAAATGTGTGTTATTCTCCTATGAGCATCTCCTCT

GCTCTAGCCATGGTTCTCTTGGGTGCAAAGGGAGACACTGCAGTCCAGATATGTCAG GCACTTCATTTAAACCCAGATGAAGATGTCCATCAGGGCTTC

CAGTTGCTTCTCCATAACCTGAACAAGCCAAACAACCAAAAGTACTGCCTTACTATGGCCAACAGGCTCTTTGTAGAAAATACTTGTGAATTACTTCCA 

ACATTTAAAAAGTCCTGTCTTAAATTCTATCACTCTGAGATTGAGCAGCTCTCTTTTGCCGAAGCTGCAGAGGAGTCCAGGCAACACATAAACATGTGGG

TCTCCAAACAGACTAAAG GTAAAATTCCAGACTTATTGTCAGAAGACTCAGTTGATTCACAGACCAGGCTAATTCTCGCCAATGCTTTATACTTCCAAG

GAACATGGTGTAAATTCTTTGAAAAAGATAGCACCAAGGAAGTGCCCTTTAAGATAAATAAG AAGGAAACAAGGCCAGTGCAGATGATGTGGCAGGAAG

ACACATTTTTCCATGCCTATGTGAAGGAAATCCAGGCACAAGTGCTGGTGATGCCCTATGAGGGCATAGATTTGAATTTCGTGGTCCTACTCCCAGATCA

GGGTGTGGACATCAGCAAG GTGGAAAACAATCTCACCTTTGAGAAGTTAACAGCCTGGACCAAACCAGAGTTTATGAATCGCACTGAGCTTCATGTTTA

TCTTCCAAAATTTAAACTACAAGAGGATTATGATATGAATTCCCTATTACAGCATTTGGGAATCTTGGATGTCTTCAATGGAAGCAAAGCTGACTTCTCA

GGAATGTCTACTAAGGAAAACCTGTGTCTGTCCAAGTTTGTTCACAAGTGTGTAGTAGAGGTCAATGAAGAAGGAACAGAGGCTGTTGCAGCCTCTGCTG

GCAAAATTATACTTTTCTGTGATGGTCCTGATCCCGAAGTTTTCTGTGCTGACCACCCCTTCCTTTTCTTCATCATGCACAGCACAACTAACAGCATCCT

GTTCTGTGGCAGATTCTCATCTCCATAAGGCATATTTTTTATGGGGTAGAGTTCTCTCTTGGCAACTCTACCACTTCTACTGCTCTGTGAGAATGGACAA

GTGGGTGGAAAACATGTTCCAAGATGAAGGAACTTTCATCTTTTCATTCTGATCTAGTGATGCCCACATTCAGCTCTCCCTACCCTGATATTAATTTGTG

TCCTTTGCCAGGACAGATGACCACAGAGTGTTATGAATTCCCTTATAGATTAGAAGGCAAAGAGAATCCTCAAGATAACCTACAATGATCTCTAAAGTAA

CCCTAAATAAACCTCCAGTCAATCCACAGACAAACAATGGCATCAAAATACATAGTCTTTTCTTGGAACCACAACACTTGCCCTTACTTGCCTTATTCTG

ATTTTATCCTAACAAATGCTTCTCTGGGTGAGGACTGCTACTTTTATTTTCCTGGTATCTGTTCCGTATGCACATATGAAATTCATTTTCCTTTCTGCCT

ACTACTCACCAGGTATGTTCCCTATACTATGGTAGTTTGGGAACAGGTGCAGTGAGTCCTCTAACAAATGGCCTTTTCTATCTGTTTTCAATATATTTAC

ATATCATAACAACTAGTTTGGACTACCAAATGCCCTCCATGCAAAAGTCATGCTTCTACAAACTACCATGATTCTCTAAAACTAAACATAATAGTCAAAT

TCTCTGGTCTTCAAATGCATTTCAAAATAAATTTTTTATC
Translation
 - UNI31103 - MNTLSQANGTFAIHLLKVLCQDNPSENVCYSPMSISSALAMVLLGAKGDTAVQICQ ALHLNPDEDVHQGFQLLLHNLNKPNNQKY

CLTMANRLFVENTCELLP TFKKSCLKFYHSEIEQLSFAEAAEESRQHINMWVSKQTKG GKIPDLLSEDSVDSQTRLILANALYFQGTWCKFFEKDSTK

EVPFKINK KETRPVQMMWQEDTFFHAYVKEIQAQVLVMPYEGIDLNFVVLLPDQGVDISK VENNLTFEKLTAWTKPEFMNRTELHVYLPKFKLQEDYD

MNSLLQHLGILDVFNGSKADFSGMSTKENLCLSKFVHKCVVEVNEEGTEAVAASAGKIILFCDGPDPEVFCADHPFLFFIMHSTTNSILFCGRFSSP

For any suggestions or comments, please send an email to unitrap@crg.es