Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000062393 (Dgkk)
Chromosomal location
Chr X: 6356426 - 6523902 (+)
Description
diacylglycerol kinase kappa Gene [Source:MGI Symbol;Acc:MGI:3580254]
RefSeq_peptide
NP_808582.3 
UniGene
Mm.335953 Mm.464416 Mm.468100 Mm.469585 
MGI
MGI:3580254 
Uniprot/SPTREMBL
A2AEP1 Q6DIC8 
Human Ortholog
ENSG00000204466 (DGKK)
Omim not available
UniTrap UNI31174
Vector Insertion
Chr X: 6485891 - 6501289
Public Clones IST10324H11 (tigm) IST10025A12 (tigm) IST13432E12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 49% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32082
Vector Insertion
Chr X: 6501390 - 6503069
Public Clones IST11074G1 (tigm) IST13920F4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 51% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31480
Vector Insertion
Chr X: 6507101 - 6510027
Public Clones IST13391B10 (tigm) IST13359D4 (tigm) IST13749A5 (tigm) IST10299B4 (tigm)
IST13536F2 (tigm) IST14118C8 (tigm) IST13034C3 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 67% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI32705
Vector Insertion
Chr X: 6518047 - 6520702
Public Clones IST10618F11 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 94% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000067410
Sequence
AGAGCCGGACCCCGAACCAGACTCAGAACCGGCCCCAGAACCAGTCTCAGAGCCGGCCCCAGAACTTGTCCCAGAGCTGGCCTCGGAGCCGGCCCCAGAA

CCTGTCCTAGAGCCAACCCTAGAGTTGGCCTCAGAACTGGCCCTAGAACCAGCCCCAGATCCTGCCATGGAGAGGGCCCCAGAGTCCTGGCCAGAGCCAA

CTCCAGAGTCCTGTCTAAGAATGAGTCCAGCACTACATCTGTTGCAGGTAGTTCCTGGAGAGAAAAGTGGAACAGCATCTCCAGTGCTATTGCCATTGCC

GTCGCCCAAACCGCCAATAACGTGGTCCAGAATAAAG AAAATACTGAAGGAAGGACCCCTGCTGAAGAACTGTAACTCCTTCAGAAGATGGAAGCTTAG

ATACTGTCTGGTTCAAGGGCAGAAGCTCCACTTTGCACACCATCCTTCG TTTGCACACTTTGAAACAATTGATCTGTCTCAAGTTGTTTTGGCTGAAAG

TAGCTGCAGAAATCTTTGCCATGGTTTTTGT GTTATCACACCACATCGAAAAGTGTCTCTAGTTGCACCCACTCGGCAAGACATGGAAGAATGGATTAA

CATCATAAAAACTGTCCAACAAGGAGAAATCCGTCAG ATCCCTGCAGCCGAAAACAACCCCTTTCTTGTCGGAATGCACTACTGGTATTCCAGTAGTAA

TCCCCGGAGTCACTTCTGCAATGTTTGTCGAGAGAACATTCCTGCTTTATCTCGAGATGCCGTCACCTGTGAAG TCTGTCAGGTGAAATCTCATAAATT

CTGTGCTTTGAGAGCAAACAAAGACTGTAAATGGAATACTTTATCCGTGACTGATGACCTTCTTCTACCCGCTGATGAAATA CAAACAATGCCGCATCA

GTGGGTAGAAGGAAATATACCCGCTGGCTCTCAATGTGTCGTATGTCACAAGAGCTGCGGTAGTCATCACAGACTTCAGGATTTCCGCTGCCTCTGGTGC

GGCTCTACG GTGCACGGGGCCTGCCAGAAGCGGTTTTCCAAGGAATGTTCCTTCGGAAGTCGTCGCTCGTCCATCGTGCCACCAACGGCACTGAGCGAC

CCTAGGGGCGATG GCCAGCTAGTAGTATCGCCTGACTTCTGGAATCTTGACTGGCCACTGACTTGTTCCTGTCCCTTGCTCATCTTCATCAACTCTAAA

AGTGGAGATCATCAAGGGATCATCTTTCTCCGGAAATTCAAACAATACCTTAATCCGTCTCAAGTATTCGACCTGGCGAAGGGTGGACCTGAAGCAGG C

ATCGCTATGTTCAAGAACTTTGCCCGTTTTCGTGTTCTGGTTTGTGGTGGAGATGGCAGTGTGAGCTGGGTCTTGTCTACGATTGATGCCTATGGATTGC

ATGATAGG TGTCAGCTGGCGATCATCCCACTTGGAACTGGTAATGATCTCGCTCGTGTCCTGGGCTGGGGAGCAGTCTGGAGTAAAGGCACATCACCAC

TGGATATTCTCAGCAGAGTGGAGCAGGCTCACGTGAGGATTTTAGACAG ATGGAGTGTGATGATCCGTGAGACCCCCAGACAAGCCCCGCTGCTGAAAG

GACAAGTGGCAATGGATATACCAAGATTTGAG GCTGCTGCCATCAAGAACGTAGAGTCTGCAACCACTGAGTTGAACAAAATTCTGAAGGCCAAATATC

CCACGGAGATGGTCATCGCCACAAG - UNI31174 - ATTCCTGTGCTCAGCAGTGGAAGATTTTGTGGAAGATATTGTAAAGGCCTGGCACCAAATA

AAACAGAACAGCACAGCAGTGGAGTCTGTGATTTTGAAA - UNI32082 - AGCGACTTAATGTATGATAAACTCAGTGTCCTTATTGATCTCCTGGC

TGAGGATGCAGTAGCTGCCTCCGCTGAGAGGACAGCCACAGCATATGGAAGCAGAAGCCAAGCAGATGGAAAACCCTTCGTGCCTCAACTAGACCACATA

GCAAGGGCCAAACTGGAGTTGGCTGAAAGGGCTCAGAAACTCCAGCAGTCCTTGAAACTCATCATATTCCAGGTCGAACAAG TTCTGGATGAAGAAAGC

AGACAGAGCTTATCAGTTAAGAACTTTACTTCATCTTTGTTCCTGGGAGACGGAGACGACGACGACTCAGATGACTATGATCAGAGCCCTAGACACC GT

TCTCGTTGTGACATCTTATGTTCTATACCTTCTCTGAGAAATGAAGACCTAGATAACCTTGACTTAGAACACTTACACATTGCACCTGAAACGAT ACGC

TTCAAAGAAAAGTGTGTCATGAACAACTACTTTGGAATTGGACTAGACGCAAAAATCTCTCTGGAGTTTAATTCCAGAAGAGAAGAACATCCAGAACAAT

ACAA - UNI31480 - TAGCCGCCTCAAGAACAAAATATGGTATGGTCTTCTGGGAAGCAAGGAATTACTGCAACGCTCTTACAGGAAATTGGAAGAG

CGAATACACCTCGAG TGTGATGGAGAAGCTGTCTCCTTGCCAAACCTTCAAGGCATCGTAGTGCTCAACATTACGAGCTACGCTGGAGGCGTCAACTTT

TGGGGAAGAAACAGAGCAACCACA GAATATGATGTCCCTGCAATCAATGATGGGAAGCTAGAGGTTGTGGCAATCTTTGGTTCTGTGCAGATGGCCATG

TCTCGTATCGTCAACCTGCAACAACATCGAATTGCGCAG TGCCATGAGGTGGTAATAACTATTGATGGTGAAGACGGTGTCCCTGTGCAAGTGGATGGG

GAAGCCTGGATTCAGAAGCCAGGCCTTATCAAGATTAAATACAAGAATGTTGCCCAGATGTTGATGAGAGATAGG GACTTTGAGAACTCAATGAAAACC

TGGGAATCTAAGCATACTGAAATCCAAGCTGTCCAACCACCCCACCTGGATTTCCAGGAATCTCAAGACAGCCTCTCTGATGGAGAGTATGCCCAGATGC

AGCACTTGGCTCGGCTTGCAGAAAACCTCATTAGCAG ACTTACTGACCTAAGCAAGGTCCACCAGCACGTGTCTGTCCTCATGGATTCTGTGAATGCCA

GTGCTAACATACTGAATGATGTGTTCTATAGCCAAGACAGTGGTAACGAAGCAGGCGCAGCTTCCTGCATTCCCATTGAG ACTCTAAGCAGAACTGATG

CAGTAGATGTTACATTTAGTCTTAAAGGGCTCTACGATGACACCAAAGCTTTCCTGGATGAAAACTTG TTGAGAGATGCTGAGGATCGGGCCATGCTAC

AAACTGCCTTGGATGCCATGAATACAGAGTTAAGAAGGATACTGGCAATTGGCTGGCTGAGTCAAATCTTCTTTCCAGAG - UNI32705 - GAACAG

GCTTCTGACACTCGCAGTTTAAGTCGTAGGTTTAGAATAAAATTCCCCAAGCTGGGGAAGAAGAAACAACGAGAAGAGGGAGAAAAGCCTAAATCAAGCC

AAAGATTCCCTGGTTTTCTTG GCAAGTTCTGGCGTCGAAGAAATCGTAGCAATCGAGCAAAAGCTGATGACCCTCCAACACCTTCAAGTTCTCAACTAT

AGTCCTTGAAAGCTGGAAGGAGAGCTCTCAACACAGAATTCTACTAAAAACTCTCAAGACCTCAAGAAAGGCTGAACTAAATTATTTCTGAACAAACATG

AGCACCACCAAGAAAGACCCTCCAAATCCTTATACTAATATGTTTTCCCCAGACTTAATCAGATCACCTTAGAGGGTTACATTTTTCTCGTTGGCCAAAG

ATTCTTGTTCCGAGTTGTCTTGTTCAGTTCTTCTCGTTGTGTACCTTGGGCAACTACAGTGTTTATTGGGGACAGGCTCTCTATGAATGGCCTGGGAGCT

ATGAGAATGTATGGGAGTGCATCTCGTTAGGAAATATTAGAATGGGGGGTCTTTCACTTGGAGAGAAACTGTTGACACCAAGGAATAAATGAGTGACCAA

GTCTCAGAAAGATGAGGAAGGGGAAGGGTGTCCAGGCTTAGTTGTGTTTCTCCTCCAATCCCTGCCAATTGCAACTTGAATTTCAAAAGATGGCTCCTAG

TTGGCTTAAGAAGATGAGAACAAGGTCCTGGGGCTTGTCCACTCATCTGTTACAATGACTATGTGAATCTTTTCTTATAGATATAGAACTCTCCTCTTCT

CTCTTTCCTTTCTCCTCTCATTTCCTCTTCTCTCCTCTACCACCTCTTATCTCCTCTACATCTCTTCTCTCTCCTCTCACTTCTCTCTTTCTCCACCTCC

TTCTAATTTCTTTCCCCTTTCTTTCCTTTCCATCTCTCCTTCTCTTCCACTTTCCTCTATTACTCCTTATCTCCCCATAAACTCTTCGTGTTTTTCCATG

TGTACATGTATGTCTTTGCACATGTCCAGGTGGTGCTCTCGTGGCTGGGTGGGCCCACTGGTTGGAACTCACCCCTCATGGCAACCATACAGGCTCCTGT

ACTTTTGCCTTGATCCCAGCCTGCATGTCTCCATGGAGTGCTTGCCTGCATTCTCGCTGGATTTTTTAACTAAATGTTTTGCCGCTGTGCTGCAGTATAG

ATTATATACAGAGACATAAAGATGTACATATATATACATATATATTTTTAAGAACTGAAAATACAACTCGACCTCTAAGTGACCCTCTAATTTATTATGA

TAACCCAGGAATCCCTCCTCATCCCTATTACCCTATACACATATATACTCTACCAACTGCCCTAGTTCTTGGTGGAGCTTCTAATCTTTTGGTGCATTTT

TTAGTGTCTTAGAAGTAGCTGGGGTCTATATATCCCAGCTAATTCTGACATCCACTTCTGAGCCAGGCCACAGAAGGGGAACAAAAACACCAATGCCCTG

CCAAAAGGGCCCAGCTGGCATGCTGCCATTTAGCTCTGTTTCTCCTGGCTCTACATCAGTAACTGCCCAAGCTATATCACCCTCCTCCCCAATAAAAAGA

TGTCAAAGAGCTCTACCCTTTAAATGTCTAAGTCAGGGTCTACCTGACAATAAAACCACAGCCCATGCCCCTCCCCAAAAGCTTAATCTGGGCCTGCAGC

TATTAGATAAGCTGTTGGGTCACTCCTCAAATTATCTTCAAATCTCATATCTTACCCCCTCCCCCCCCCCCCAGAGTATAAGAGAGGCAGTCAGAGTGAC

CAGAAAGAACATTGATCTGGGAAAAGAAAGGCGAAAAGCCTCTGCTTCCCCACTGTTCTGCTTCCAAGGTGGTTTTCATGAACATAGTCGGTCTCCAATC

TCAGTCAAGTAAATCTGCCGAGAGTGCAGTGCTCAGAAAGAAGGTCTCTGGTCTACCTCCTCTTCACCCTCAAGTCGCACCTTTTGGAACAAGTCCCTTC

CCACTTATCAAGAAAAAGATCCAGAAAACTGCCCTTTTCTCACTGCTCAGCCAAACTTAGCGTGCTCAATTACCTTGCTCAGTCCAATGGCTGGTTCACT

GAGGTGCACAATCCAGACTTCGATCACTGGTTCTTAACTTTCTAGAACACCACCAGCCTAACCCACTTAAACCAGCTGCCTGTGTTCCACCTCTTCAAGG

GTGAGAAAAAGAGACTAACAATGGGGTAGTCCCCAAACATCTGATAGCTGTGCC
Translation
EPDPEPDSEPAPEPVSEPAPELVPELASEPAPEPVLEPTLELASELALEPAPDPAMERAPESWPEPTPESCLRMSPALHLLQVVPGEKSGTASPVLLPLP

SPKPPITWSRIK KILKEGPLLKNCNSFRRWKLRYCLVQGQKLHFAHHPS FAHFETIDLSQVVLAESSCRNLCHGFC VITPHRKVSLVAPTRQDMEEW

INIIKTVQQGEIRQ IPAAENNPFLVGMHYWYSSSNPRSHFCNVCRENIPALSRDAVTCEV VCQVKSHKFCALRANKDCKWNTLSVTDDLLLPADEI Q

TMPHQWVEGNIPAGSQCVVCHKSCGSHHRLQDFRCLWCGST VHGACQKRFSKECSFGSRRSSIVPPTALSDPRGDG GQLVVSPDFWNLDWPLTCSCPL

LIFINSKSGDHQGIIFLRKFKQYLNPSQVFDLAKGGPEAG GIAMFKNFARFRVLVCGGDGSVSWVLSTIDAYGLHDR CQLAIIPLGTGNDLARVLGWG

AVWSKGTSPLDILSRVEQAHVRILDR RWSVMIRETPRQAPLLKGQVAMDIPRFE AAAIKNVESATTELNKILKAKYPTEMVIATR - UNI31174 -

 RFLCSAVEDFVEDIVKAWHQIKQNSTAVESVILK - UNI32082 - SDLMYDKLSVLIDLLAEDAVAASAERTATAYGSRSQADGKPFVPQLDHIAR

AKLELAERAQKLQQSLKLIIFQVEQV VLDEESRQSLSVKNFTSSLFLGDGDDDDSDDYDQSPRHR RSRCDILCSIPSLRNEDLDNLDLEHLHIAPETI

 IRFKEKCVMNNYFGIGLDAKISLEFNSRREEHPEQYN - UNI31480 - NSRLKNKIWYGLLGSKELLQRSYRKLEERIHLE CDGEAVSLPNLQGI

VVLNITSYAGGVNFWGRNRATT EYDVPAINDGKLEVVAIFGSVQMAMSRIVNLQQHRIAQ CHEVVITIDGEDGVPVQVDGEAWIQKPGLIKIKYKNVA

QMLMRDR DFENSMKTWESKHTEIQAVQPPHLDFQESQDSLSDGEYAQMQHLARLAENLISR RLTDLSKVHQHVSVLMDSVNASANILNDVFYSQDSGN

EAGAASCIPIE TLSRTDAVDVTFSLKGLYDDTKAFLDENL LRDAEDRAMLQTALDAMNTELRRILAIGWLSQIFFPE - UNI32705 - EQASDTR

SLSRRFRIKFPKLGKKKQREEGEKPKSSQRFPGFLG GKFWRRRNRSNRAKADDPPTPSSSQL

For any suggestions or comments, please send an email to unitrap@crg.es