Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000062524 (Ncr1)
Chromosomal location
Chr 7: 4289326 - 4296766 (+)
Description
natural cytotoxicity triggering receptor 1 Gene [Source:MGI (curated);Acc:Ncr1-001]
Human Ortholog
not available
Omim not available
UniTrap UNI35794
Vector Insertion
Chr 7: 4289969 - 4292361
Public Clones IST10103A12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 37% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000006792
Sequence
GTTCAGCACTGGTCTGGCCACTGGTATGCTGCCAACACTCACTGCCCTACTGTGCCTTG GGCTATGTCTGAGCCAGAGGATCAACACTGAAAAGG AGA

CTCTCCCGAAACCCATCATCTGGGCCAAACCCAGCATCATGGTCACAAATGGAAACTCGGTGAACATCTGGTGTCAGGGGGCTCAGAGTGCTTCTGAGTA

TCAACTGTACTTTGAAGGAAGCTTTTTTGCCTTGGAGAGACCAAAGCCATCGAGATCGATGAATAAAGTTAGGTTCTTCATTTCACAAATGACCTCACAT

ACTGCAGGGATCTACACCTGCTTCTATCAGAGTGGAGAGCTCTGGTCAAAGTCGAGCAACCCCCTGAAACTGGTAGTAACTG - UNI35793 - GTCT

GTATGACACACCCAACCTCTGGGTTTATCCACAGCCTGAGGTAACCTTGGGGGAGAATGTTACCTTCTTTTGCCAACTGAAGACTGCCACAAGCAAATTC

TTTCTGCTCAAGGAGAGAGGATCCAACCACATCCAGAATAAATATGGGAACATCCAAGCAGAGTTTCCCATGGGCCCCGTGACTAGGGCTCACAGAGGGA

CATACAGATGTTTTGGCTCTTACAACGACTATGCATGGTCTTTTCCCAGTGAGCCTGTGACACTACTCATCACAG GAGGTGTTGAGAACAGCAGCCTTG

CACCTACCGACCCTACTTCTTCTCTTG ATTATTGGGAGTTTGACCTTTCAACCAATGAATCAGGATTACAAAAGG ACTCCGCCTTCTGGGATCACACA

ACCCAGAATCTCATTCGAATTGGTCTGGCATGCATAATCCTGATAACTCTAGTATGGCTTTTGACTGAAGACTGGCTCAGCAAGAGGAAAGATCATGAAG

AGGCCAACAGATTAACAAATTGGGAATGCAGGAGAAGATGGAGAATGCAGCATTACTTTGAAGAGGAACAAAGAAATGCAATATCTATGATGGAACTGAA

GGCAACTCCTGGGGCCTTGTGAGCTCTATGCTGTACCCTGGATAAAGAAAGAGATCTTTTCAGAAATGAAGGGGTAGGAGTGTTACCAAGTTTGGCAAAG

CATTCTAAAGGACACTGTGAGAGGAAGCCTCTAACAGACCTCTCTGTCTCTGCTAAGCTTTAAGTACTTTAACGCTTATTTACTGCAAGTTATACTTTTG

ATCACTCTGGTCTTTCCTAGAAATAACTTCGTTCCAATGTGATGGCCATGGGAATATTTCCTTCCTACTTTAGGTCTTATCGTCATTTCTTTTTCTAATT

TTATTTATTTTATGTTGCCGGGAATTGAACTCAAGTTGTCTGGAGGAGCAACAAGTGCTCTTAACTACAAACCATATCTCCAGCTCCATCCTCAATATTT

TATATTGTGTGTGCATGTCTGTAGGATGCATGTGTGTGCACACATATGTACATATATTCTATGCCATTAAAATGAAGGTCAG
Translation
MLPTLTALLCLG GLCLSQRINTEKE ETLPKPIIWAKPSIMVTNGNSVNIWCQGAQSASEYQLYFEGSFFALERPKPSRSMNKVRFFISQMTSHTAGIY

TCFYQSGELWSKSSNPLKLVVTG - UNI35793 - GLYDTPNLWVYPQPEVTLGENVTFFCQLKTATSKFFLLKERGSNHIQNKYGNIQAEFPMGPVT

RAHRGTYRCFGSYNDYAWSFPSEPVTLLITG GGVENSSLAPTDPTSSLD DYWEFDLSTNESGLQKD DSAFWDHTTQNLIRIGLACIILITLVWLLTE

DWLSKRKDHEEANRLTNWECRRRWRMQHYFEEEQRNAISMMELKATPGAL

For any suggestions or comments, please send an email to unitrap@crg.es