Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000062627 (Mysm1)
Chromosomal location
Chr 4: 94608732 - 94645791 (-)
Description
myb-like, SWIRM and MPN domains 1 Gene [Source:MGI (curated);Acc:Mysm1-001]
RefSeq_dna
NM_177239 
RefSeq_peptide
NP_796213.2 
UniGene
Mm.208868 Mm.406037 Mm.468748 
MGI
MGI:2444584 
Uniprot/SWISSPROT
Q69Z66 
Human Ortholog
ENSG00000162601 (MYSM1)
Omim not available
UniTrap UNI9157
Vector Insertion
Chr 4: 94641984 - 94645694
Public Clones RRE042 (baygenomics)
Private Clones not available
Severity of mutation (?) Insertion after 3% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI4894
Vector Insertion
Chr 4: 94639680 - 94641907
Public Clones AR1219 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 6% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI1686
Vector Insertion
Chr 4: 94623830 - 94625603
Public Clones CF0781 (sanger)
Private Clones not available
Severity of mutation (?) Insertion after 63% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI28004
Vector Insertion
Chr 4: 94615126 - 94617616
Public Clones not available
Private Clones OST42553 (lexicon)
Severity of mutation (?) Insertion after 87% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000075872
Sequence
GGGATCTCGCGAGTACGCCTGCGTCAGGTGCAGTCATGGAGGCGGAGGAGGCGGATGTGGATGTGGAAGGAGATGTTGCGGCGGCTGCACAGCCGGG - 

UNI9157 - AAATGATGAAAGTACAGCATCAGTTTTTCAAGATCACTATCTTGATTCAACGTGGAGAAGGGAAAATGGCTGTCTT - UNI4894 - C

CTTGGACTCTGGATAGCACCATCAGTGATGAGAACAGAGCTATCATTGAGAAAATGCTGTTGGAAGAAGA GTATTATTTATCTAATAAATCACTTCCAG

GAAAATTCTGGGTTAATCAAAAGGAGGATAATAAAAAATACACAAACAG CCTGCAGAAGTCATCAAAAGCCAT GGTAGATTCTCCTGCAAAACCAGCC

AGTCATTCAGTAAAGTGGACAGTAGAAGAGAAAGAGCTGTTTGAACAAGGACTG GCTAAATTTGGCCGAAGGTGGACCAAAATCGCAACACTACTTAAA

AGTCGCACAGTTTTACAAGTGAAGAGTTATGCCAGACAGTACTTTAAAAATAAG GTAAAGTGGGATGTGGAAAAAGAAACACCAACTCAGAAGAGCAGC

AGTGATCTTCAGGTTAAAAACAAAGATGACAGGACGAAGGCGTGGGCAGCAGCCTGTTTAAGGGGAAGTGCTGATCCCTGCCTGAATGCTGTAAAGATTG

AGAAGTTATCTGACGATGAAGATGTAGATATCACAGATGAGCTGGATGAGTTGACTTCTCAAACATCACAGAATTCTGGCAGCCATCTTACTTTAGATGT

TCCTAATAGTAAAATGTATACCACCAATCAAGGAGAATTATGCCAAGAAGGTCCATTAGCTAAATCTTCAGGAGAGTCTCTTCAGAATGTGAAGCAAGGT

GAAGGAGAAGCATGTTCAAGCTCAGAAATTGCATCATGGGCTGAAAAACAGAAAAGTACTGACAAAAACTCAGCCGAATTAAATGAGAAATACAATAAAG

TGGTGGAAGAACACACTCTACACAGAGGAGAAGTAAGAGAGGAAGCCAAGCACTCGCCTTCTCCAGAGCCCTGTGAGAGGCAGGACTCAAGTGGAAATGA

AATGCTTTTGCCTCCTTGCCAAATTGAGGAGGAAAACCATGAAGGAGAAGAGCTTAAGCCACCAGAACAAGAAGTTGAAATAGATAGAAATGTCATTCAA

GAAGAAGAAAAGCAAGCGATTCCTGAGTTTTTTGAGGGGCGCCAAACTAAAACACCAGAACGCTATTTGAAAATTAGAAACTACATTTTGGATCAGTG G

GAAATATGCAAACCGAAATACTTAAATAAGACCTCAGTACGTCCTGGCCTGAAGAACTGTGGGGATGTTAATTGTATTGGACGGATTCATACATACCTCG

AGTTGATAGGAGCAATCAATTTTGGATGTG AGCAGGCAGTATATAACAGGCCACAACCACTTGATAAAGTACGAGCGGCCGACAGAAAGGATGCAGAAG

CAGCATACCAGCTTGCCTGGCGCCTGCAGTCTATG CGAACGAGGAGACGCAGGGTCCGAGATCCATGGGGAAACTGGTGTGATGCAAAAGACTTAGAAG

GACAAACATTTGAG - UNI1686 - CATTTGTCTGTGGAGGAGATGGCAAGAAGAAAAGAAGAGGAAAAGTGCAAACCTATTAAATTTTCGAAAGCTT

CAAAACTTCCAAAAAG CTCACTTGATCCTTTCCAACTGATACCTTGTAATTTTTTCAGTGAAGAAAAGCAG GAGCCATTTCAGGTGAAAGTAGCTGCA

GAAGCACTTTTAATAATGAATTTG CACGCCCACGTGTCTATGGCAGAGGTGATTGGGCTTCTAGGAGGAAGATACTCAGAAGCTGATAAGGTCCTTGAA

 GTCTGTGCAGCAGAACCATGTAACAGTCTGAGTACAGGACTTCAGTGTGAGATGGATCCTGTATCACAGACACAGGCCTCAGAAACCTTGGCTCTTAGA

GGCTACAGTGTCATTGGGTGGTACCATTCTCATCCTGCATTTGATCCTAATCCATCTTTACGAGATATTGACACACAAGCCAAATACCAG AGTTACTTC

TCCAGAGGAGGAGCAAAATTCATTGGAATGATTGTTAGTCCATATAATCGAAGTAATCCTTTACCATATTCCCAGATAACCTGCTTGGTTATAAGTGAAG

AAGTTAGCCCTGATGGTACCTACC - UNI28004 - GTTTACCTTACAAATTTGAAGTACAACAGATGTTAGAAGAACCTCAGTGGGAATTAGTGTTT

GAAAAGACAAGATGGATAATCGAAAAATACAGGCTTTCTAATAG CAGCGTCCCCATGGATAGAATCTTTCGCCGGGATTCCGACCTAACTTGTCTGCAG

AAA CTTTTGGAGTGTCTAAGGAAAACACTGAGCAAAGTAGCCAATTGCTTCATCGCTGAGGAGTTCTTGACTCAAATAGAAAATCTGTTCCTTTCCAAT

TACAAAAGCAAGGAAGAGAATGGACTGGCAGAAGAGGATAGTACAAAGGAATTGTTCATGTAATTATTTTAAAGTAAGATGTTCTAATCTTGGCATGCTA

CTGTAAATAATTGAGATTTTAAAGCAATATAAATTATGTTTTTTTTTTAATCCATAAAACTCTAAACTTTCTCACATAGATAATGTGAGAAGGAAGAGAG

AGCCCTTGTTCTCATAGTGGTAATCAAGAGTGGTAGAGCCCTGCCTATGCTAAGCTGTGCAGTGGGCATGAAAGCTTGAGCTCTGCTCTGCCTCGTGGTG

TGCGGCTTAATAACTAGGAGATGACCGAGCTCCGCTTTTTCTCAGAGGGACTGTTTCTCACTTTGCCATCTCATTACACACACTTTCTTCCCATATGTTC

TGGTGGTGAGATTGTGTGTGTGTGTGTGTGTGTTATTTGGATGTTGCAGCCTAGGTGTGGAACATTAATGGGGTTGAGAACTACTGACTAATAAATCTAA

CAGCATGCCAACACAGCAAAAGGGAGCATCCTTAGTAATGTTCAGACAGGAGTCCAAAGGGGAGAAGAACCAATTTTCAGTCTGCGGTGTGTGCTTCATC

TTACTGTGTACACTATACCATAGGACAGTCAGCCTCCTCTGCGATTTAAATGTTTAAATGAATTTCACAAGGGAAATAATTAGCTCCAACTCTGTCCAAT

TGCAGTAGCATGTGACAAAATGTCATTGAACTAGACTTGGTAATGTAGCCCTCAACCTAGCTTTTTTCCCTACTGTCAGGAGAAAGAGAAAAATGAGTCA

CATATTACAATAGAAAAAAAAATGCCATCTGGTATTTTACATAGCTTAACCCAGTTTCATGCACTTGCTGAATATTAAAAGTAAACTTTTTTCATGTTGT

AAATTCAAATTGTTCATGTAAGTATTAGTGAATATTTCTGCTTGCTGGAGAACTGGTGTTTGACCCTGTCCAGGCCTTCTTATTGGCAACAGTTTTGTTA

TATTGAAACTGAATGTGAGTTTAGAGTTTTCTTTTTTCTTTTTTTTTTTTTTTTTTTTTGCTGTAGTTGTAGCCAAAGGGGGAGGCAGCACTGGATGGAG

TGACTGCAGTCATAGGTGACCTGAATCTGATTTGGGCACTGTGATTTAAAGAAAAGGCGTTTGCTTTCTCTAGGCCAAGTTTGTCTTATGTAGCTGAGGC

TAATCCAGCCCTGAGTGTTGCTCCTACTCTGATTTATCTGCTGGCTTGTTAGGCTGCACTTTTGGAACTTTATAAGATCGTGTAATTGCAAAATTAATGT

GTAGCTTTAAAAGAGAACTAGCAGTTTTTCCATTTCCCTCTGTACATTTAATACGAACAATGAAACATACTTTGTAAAATCCTCTTGAAATCTGGAAGTG

CAAGGACTCCAGAGCAAAAATCAGGAATCCTGAGCTCTCAACCTAATCTGCTTAAGCTTTGGTAAGGGGCCTCGCTCCACGCTCAGCTCTCTAAACTCAT

CAGTTGAGATTCAAAGAGCTGAATTCTATCACTTGTTGTCTCTTCAAGCACACAAGGCTACAAAAGTCAGTAGCAATTAATTCATTCCTTTCTGTTTTCC

TTCCTCTTCACCTGTCTCTTCATAGGCTGTTGGCACAGACCTGAAATGGATGATAATTTACTTTCTTGCAATTTTCCTAGAATGCTGTTGAATTTTAAAA

AGTTCTTTCTCAAATCTGGACTTTACACATGCCAGTGGTTAAGAGTATTCACTACCCTGATCTATACATTGTAAGGACCCAACGGGTGCCAATAGTCAGA

GTGTAGGGCCTTGAGAACAGAAGTTTTTAAGCAACTATTGAGAAAATACAACTATTTTCTGACTGTAGAATATATTTGTAATTTATCTTATGAAATATTT

TTAAATACAGTGAAATATATACAAAGTGCAAGTATCTCAAACCTACTGTTGAGGAAATATTTTACATAGGAATCAGATTCTTAACCAGTTTTTAACAGCA

TAAATTCAGGATATTCAGTTATTGTTTGTCTGCTTTTGTTTTCTGTCTGTTCTCTGTGCTGCCTTCTCTTCTCTTGTCCTAGTGTCTACTTGCTCTGGCA

GCTGTAGGTGGCCAACCTAGGCCTCCTGAGACTGGTTAGAGCCAAGACCTTAAAGAAGCACAGATGAGTCTGGAACTTGAGGGGACATGTAACACAGAAG

TTCATGGAGAGAGAGAGAGAGAGAGAGACAGAGACAGAGACAGAGAGAGACAGACAGAGACCGCCCTTCCCAACAGTGTTTGCAGAAGTGGAGGACCAGC

AATGCCTGAGTCTCTTTATCCTGGGTTCTATTTTTATTGGTGCATAAAAATAGAAATTGAGCTTAAATTTTGTCTCTTATTCTGACATGGTTAAGGACAC

TTAATAATAGTACTTCTCTTATATTAGACTTACTGTTCTTCAAAACTAATACTCAAGAAAGCAAAATCAGTGGAACAAGACCAGTAAGGTAAAACTCGCT

GGCCATTGTTTAACCTTGGCCCTTCTTCTCCACTCCTTTTAAATGGCTAGGAGCTCCCAGTCTTGGAGTTGGTATGGCCACCTGCTCAATGCTCATGAGG

TTTTAGGCACCAAGCACTTTAGCTCACTTTGACCTCTTCCATATAGAATTTAAAATTACATTTTATAATTGTGTTTGTATAACATGACAGTATTCACATT

TTGGATTAAAATATTCCTTTAATCTAAAACTTGGATTATTTTTCCTAATAAAATTAAGTAAAATGTTTGTTATACACCCTTCAAAATTCTGAGAATTTGA

GACTGTACCTGATGAATGGTTTATGTTCTGAGAGGGTTGTTGGAAAAATGCAGACCGTGTTCTCCATCCCTTACCACCACTCAGGTGTTTGTTTCACTCC

AGCCAGGAGCACTGCAGGTCCTCCTGTCACAAGCCTGGACATCTGAACTTCGTCCTTCCCATCCTAGCCAGAACTCAGTATGGCTTAGATCATCCATGGG

AGGCGGAGGTGCAGTAGTTAGAAATCAGTAGATAGGAATTTTATTTAGGTTCCTACTTTTACAGCTTGTGCGCCACCTCACAGGGTGAGGTGCCTTTTTT

CCCTTTACTGTCAAACCCTCATATTCATCTATTCATCCATTCTCACAGCTCATAGGTACAAGAGCTTTATATCATTCATTGAAAGTAATTAAACAGACCC

ATTCAGAAAATGCCTGCAGTCATTTATTGTTTAGCATTGGTCCAGGCTTCTCCACAGAATGTTCCTCTCGGGCTAGGTGAGGTTGGTAGCATGCAGACTG

GAAGCACCGTTAGCCTCTTCGTTTCTAAGGACAGAGAAAGTGGCAGCCCCGGCATTCCAGCCTAAGCTGTCCTACTGCTCTTTAGTTTACCTTTTCCCAT

GTACATTGCTGAGTCCTGACGGAAGGAAGGCGCTAGAGAAGCCAACAAAGCCTGTGCACGCCTCCACTCTGTCTCTGCTCTGTGCCAACTGAAGACACCC

AATTGGCCACCTGCTTGTGGACACACTTGAAGTTCACCGGCAGACATCCTATGTTGGTTTCTCAGCAGGAGAGGTGGCCACCCAAATTTCCCTTTTCTAC

TTACCAGCAAGGCACTTAATCTGGTGTCACGTGACACTCATAGAGAAAAGCACCTGCACAGAAGCACAAGAAGAGCACACACATTCTGTTGTGTTAGCAT

TAACAAACTTAACGAACAAACTTTATCTCTAGAGCTTCATCTCTAGTTTTGTATTTAGCTCTTAGAACAATATATCTTATAATGTATCCAGAAAAATCAG

AATAATGTAATATCCTTCGATTATTATTTCCTGACCTTTCTGAAAAAGTTTCATGCATGCTTTCATTTCCTGTAACTTTGTTTTCTGATATCTCTTCTAC

CTTACTCCCTTATTGCCCCGACCAAATCAGGAGGAAATAAAAGCATCCAAGAGGAACTTAAAAGGTTCTAAATGAAACTAAACTTTAAAGCCGAAATTAA

TTCGCAGCATCTGTGTAGCTTTTATTTTTGTCCTTTGCTGTTTCTGTCATATATTCATGTGAGTTCCAGGGAAAATAACCTGCTTTGTTGTGTCTGAGGG

TTCCTAGTAGCTTATCAGGAATTCAATAAATTCATATTTCCGGTGTTATATGTTATCAAAAAATTGAGGCCTGTGTGGTGGTGCACACCTTTAATCCCAG

AACTCAGAAGCAGAGTCAGGGAGCTCTCCAGTGCTCAAGGTTAGCCTGGAACAGGAGGACTACATAGTAAGACCCTGTCATTTAAAAATAAAACAAAACA

AACAAACAAACAAAAAAAACAAGACAAAACAAAGCTGGGCATGGTGGCGCACGCCTTTAATCCCAGCACTCGGGAGGCCGAGGCAGAGGCAGAGGCAGGC

GAATTTCTGAGTTCGAGGCCAGCCTGGTCTACAAAGTGAGTTCCAGGACATCCAGGGCTACACAGAGAAACCCTGTCTTGAAAAGAAAAAAAAAAAAAAA

AGATCATCTGCTTCAGCATATGAGTACTAAAGTTGTAATTAGATTTTAGCATGATTTATGTAGAGGAGTCTTTTATAAACGCCTTTAAATGTGTAGATTG

GAGTTGATTTATACAGTTGTGTTGTATATAAGATATTGCATGACAGTTTATGAACTTGTTGCTGTTTTCTCACAATATTAACAGTTTTGTAAATTTTTTC

ACTATGCATTTACAGTGTTCTATAACAATATATGACTTAAAACTATTTTATACATTTAAATGTTATGTTGTATATATCTACATTAAAGAATATTGTAAAT

ATCAATGTTTGTAAAATTATAAGTTTTCCAAAAATATAAACTCATTTTTCCATATCTACTTGTGGCATATTAAAAATACCAGTTTTTAAGCTTTGACGTA

TTATCTTGTAGTGAAAGAGGAGGATCATGCTGTCAATTCAATGTAAGCAAATGTTAAAAATAAAACAGGTAGTTTTTGATGTCTTTG
Translation
MEAEEADVDVEGDVAAAAQPG - UNI9157 - GNDESTASVFQDHYLDSTWRRENGCL - UNI4894 - PWTLDSTISDENRAIIEKMLLEEE EY

YLSNKSLPGKFWVNQKEDNKKYTNS SLQKSSKAM MVDSPAKPASHSVKWTVEEKELFEQGL AKFGRRWTKIATLLKSRTVLQVKSYARQYFKNK VK

WDVEKETPTQKSSSDLQVKNKDDRTKAWAAACLRGSADPCLNAVKIEKLSDDEDVDITDELDELTSQTSQNSGSHLTLDVPNSKMYTTNQGELCQEGPLA

KSSGESLQNVKQGEGEACSSSEIASWAEKQKSTDKNSAELNEKYNKVVEEHTLHRGEVREEAKHSPSPEPCERQDSSGNEMLLPPCQIEEENHEGEELKP

PEQEVEIDRNVIQEEEKQAIPEFFEGRQTKTPERYLKIRNYILDQW WEICKPKYLNKTSVRPGLKNCGDVNCIGRIHTYLELIGAINFGCE EQAVYNR

PQPLDKVRAADRKDAEAAYQLAWRLQSM RTRRRRVRDPWGNWCDAKDLEGQTFE - UNI1686 - HLSVEEMARRKEEEKCKPIKFSKASKLPKS S

SLDPFQLIPCNFFSEEKQ EPFQVKVAAEALLIMNL HAHVSMAEVIGLLGGRYSEADKVLE VCAAEPCNSLSTGLQCEMDPVSQTQASETLALRGYSV

IGWYHSHPAFDPNPSLRDIDTQAKYQ SYFSRGGAKFIGMIVSPYNRSNPLPYSQITCLVISEEVSPDGTYR - UNI28004 - RLPYKFEVQQMLEE

PQWELVFEKTRWIIEKYRLSNS SSVPMDRIFRRDSDLTCLQK LLECLRKTLSKVANCFIAEEFLTQIENLFLSNYKSKEENGLAEEDSTKELFM

For any suggestions or comments, please send an email to unitrap@crg.es