Tools for the biologist enabling optimized use of gene trap clones

  Homepage | Blast Search | GO Search | Advanced Search | About

Gene ENSMUSG00000062785 (Kcnc3)
Chromosomal location
Chr 7: 51846034 - 51860124 (+)
Description
potassium voltage gated channel, Shaw-related subfamily, member 3 Gene [Source:MGI (curated);Acc:Kcnc3-001]
RefSeq_dna
NM_008422 
RefSeq_peptide
NP_032448.2 
UniGene
Mm.40312 
MGI
MGI:96669 
Uniprot/SWISSPROT
Q63959 
Human Ortholog
ENSG00000131398 (KCNC3)
Omim 605259 - SPINOCEREBELLAR ATAXIA 13  
UniTrap UNI35285
Vector Insertion
Chr 7: 51847129 - 51850530
Public Clones IST10218H12 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 40% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI31083
Vector Insertion
Chr 7: 51851639 - 51853753
Public Clones IST14054C4 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 90% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI18821
Vector Insertion
Chr 7: 51853750 - 51853946
Public Clones not available
Private Clones OST413619 (lexicon)
Severity of mutation (?) Insertion after 90% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

UniTrap UNI33161
Vector Insertion
Chr 7: 51857238 - 51857512
Public Clones IST14932F6 (tigm)
Private Clones not available
Severity of mutation (?) Insertion after 100% of polypeptide chain
Proposed experimental design for vector insertion validation (?)

Show all transcripts and translations:
Transcript ENSMUST00000107905
Sequence
AGCTTTCTGTGCAACCCCACCTCCTCTAGCTAGGCTGGGTCGGAGTCTGCCTAGCCGTGGCCCCGCCCAGTCGCTCAGCCCAATCAGCTCGTGCCCTCCC

TCCACCTGCCCAATCACACCCTCCCATCCATTCATCGCCTCCTCCTGTCCAATCACGTCTGCCTCTCTACCCGGGCCCCGCCCCCGAGACCCTGCCCCCT

CCCAGCCCCGCCTCCCTGTCCAATGCTCAGTTCAGTGTGCGTCTGGTCGTTCCGCGGGCGCCAGGGGACCGGCAAGCAGCAGCCTCAGCCGGTGCCAACG

CCGCAGCCGCCTGAGTCCTCACCGCCGCCTCTGCCGCCGCCGCAGCAGCAGCAGTGCTCTCAGCCCGGCACTGCCGCCTCCCCGGCGGGTGCCCCGCTTT

CCTGCGGGCCTGGGGGCCGGCGTGCCGAGCCATGCCCCGGGCTGCCGGCGGTGGCCATGGGGCGGCACGGCGGCGGCGGCGGCGACAGCGGTAAGATCGT

GATCAACGTGGGCGGCGTGCGCCATGAGACGTACCGCTCCACGTTGCGCACCCTGCCAGGGACCAGACTGGCCGGGCTGACCGAGCCCGAGGCGGCCGCG

CGCTTTGACTACGACCCGGGCACGGACGAGTTCTTCTTCGACCGTCACCCGGGCGTCTTCGCCTACGTGCTCAACTACTACCGCACCGGCAAACTGCACT

GCCCGGCCGACGTGTGCGGGCCGCTCTTCGAGGAGGAGCTGGGCTTCTGGGGCATAGACGAGACGGACGTGGAGGCCTGCTGCTGGATGACCTATCGCCA

GCACCGTGACGCTGAGGAGGCACTGGACTCTTTCGAGGCCCCGGACTCCTCGGCCAACGCCAACGCCAACGCCGGAGGCGCGCACGATGCGGGACTGGAC

GACGAGGCGGGCGCAGGAGGCGGCGGCCTGGACGGGGCAGGCGGCGAGCTCAAGCGTCTGTGTTTTCAGGACGCGGGCGGAGGTGCCGGAGGACCTGCCG

GGGGCGCGGGCGGCGCGGGCGGCACCTGGTGGCGGCGCTGGCAGCCCCGTGTGTGGGCGCTTTTTGAGGACCCCTACTCGTCGCGGGCTGCCAGG - UN

I35285 - TATGTGGCCTTCGCCTCCCTATTCTTTATCCTCATCTCCATCACCACCTTCTGCCTGGAGACACACGAGGGCTTCATCCACATCAGCAACA

AGACGGTGACGCAGGCCTCCCCAATCCCTGGGGCTCCCCCGGAGAATATCACCAACGTGGAGGTGGAGACGGAACCCTTCTTGACCTACGTGGAAGGCGT

GTGTGTGGTCTGGTTCACCTTTGAGTTTCTCATGCGGGTCACCTTCTGCCCAGATAAGGTGGAGTTTCTCAAAAGCAGCCTGAACATCATCGACTGCGTG

GCCATCTTGCCCTTCTACTTGGAAGTGGGCCTGTCAGGTCTCAGCTCCAAAGCTGCCAAGGACGTGCTGGGCTTCCTGCGTGTCGTCCGCTTCGTGCGCA

TCCTTCGTATCTTCAAGCTGACCCGTCACTTCGTGGGGCTGCGTGTGCTGGGCCACACGCTCCGGGCCAGCACCAACGAATTCTTGTTACTCATCATCTT

CCTGGCTCTGGGGGTCCTCATCTTTGCCACCATGATCTACTATGCCGAACGCATCGGGGCTGATCCTGACGACATCCTGGGCTCCAACCACACCTACTTC

AAGAACATCCCCATCGGCTTCTGGTGGGCTGTGGTCACCATGACGACACTGGGCTATGGAGACATGTATCCCAAGACGTGGTCTGGGATGCTGGTTGGGG

CACTGTGTGCCCTGGCTGGTGTGCTGACCATTGCCATGCCCGTGCCTGTCATTGTCAACAACTTCGGCATGTACTATTCACTGGCTATGGCCAAGCAGAA

ATTGCCAAAGAAGAAAAACAAACATATTCCCAGGCCCCCGCAGCCTGGCTCACCCAACTACTGCAAGCCTGACCCCCCGCCTCCACCCCCACCACACCCC

CACCACGGCAGCGGTGGCATAAGCCCACCGCCGCCCATCACCCCTCCTTCCATGGGGGTGAATGTGGCCGGGGCCTACCCACCTGGACCCCACACACACC

CCGGGCTGCTCAGGGGTGGTGCTGGGGGCCTGGGAATCATGGGATTGCCTCCTCTGCCAGCCCCTGGTGAGCCCTGCCCATTGGCTCAAGAAGAGGTGAT

TGAAACCAACAGGGCAG - UNI18821 - - UNI31083 - ACCCCCGTCCCAATGGAGACCCTGCAGCAGCCGCACTGGCCCATGAGGACTGCCCT

GCCATCGACCAGCCAGCCATGTCTCCAGAAGACAAGAGCCCAATCACTCCCGGAAGCCGGGGTCGCTACAGCCGGGACCGAGCTTGCTTCCTTGTCACAG

ACTATGCCCCTTCCCCTGATGGCTCCATCCGAAAAG - UNI18821 - CTCTTGTCACCGCCTGAGACCTCGCGAGACCCTCGGGTTCCCCCTGTCCC

TTCCCCCCAG - UNI33161 - GTTACGAGAAGTCCCGCAGCCTGAGCAGCATTGTGGGCCTGAGCGGGGTGTCCCTGCGCCTCGCGCCCCTCGCCAC

CCCCCCTGGCTCTCCCCGGGCCACGCGCCGAGCTCCCCCGACCCTGCCCTCCATCCTCTAGCGCAGCCCTCCCCCCTGTGGGGGGACTGGGGGTGATGGG

AAGGTGAAAAGGAGCTGGGAGTAGGGCTGGGGAAAGGGTTCTTTTTTTAAAAAAAAAAAAGTCAATAATATGCAAAAGAGACGATGCCAGCAGACAC
Translation
MLSSVCVWSFRGRQGTGKQQPQPVPTPQPPESSPPPLPPPQQQQCSQPGTAASPAGAPLSCGPGGRRAEPCPGLPAVAMGRHGGGGGDSGKIVINVGGVR

HETYRSTLRTLPGTRLAGLTEPEAAARFDYDPGTDEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELGFWGIDETDVEACCWMTYRQHRDAEEA

LDSFEAPDSSANANANAGGAHDAGLDDEAGAGGGGLDGAGGELKRLCFQDAGGGAGGPAGGAGGAGGTWWRRWQPRVWALFEDPYSSRAAR - UNI352

85 - YVAFASLFFILISITTFCLETHEGFIHISNKTVTQASPIPGAPPENITNVEVETEPFLTYVEGVCVVWFTFEFLMRVTFCPDKVEFLKSSLNIID

CVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGADPDDILGSNHT

YFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKNKHIPRPPQPGSPNYCKPDPPPPPPP

HPHHGSGGISPPPPITPPSMGVNVAGAYPPGPHTHPGLLRGGAGGLGIMGLPPLPAPGEPCPLAQEEVIETNRAD - UNI18821 - - UNI31083 

- DPRPNGDPAAAALAHEDCPAIDQPAMSPEDKSPITPGSRGRYSRDRACFLVTDYAPSPDGSIRKA - UNI18821 - ALVTA - UNI33161 - 

Transcript ENSMUST00000071062
Sequence
AGCTTTCTGTGCAACCCCACCTCCTCTAGCTAGGCTGGGTCGGAGTCTGCCTAGCCGTGGCCCCGCCCAGTCGCTCAGCCCAATCAGCTCGTGCCCTCCC

TCCACCTGCCCAATCACACCCTCCCATCCATTCATCGCCTCCTCCTGTCCAATCACGTCTGCCTCTCTACCCGGGCCCCGCCCCCGAGACCCTGCCCCCT

CCCAGCCCCGCCTCCCTGTCCAATGCTCAGTTCAGTGTGCGTCTGGTCGTTCCGCGGGCGCCAGGGGACCGGCAAGCAGCAGCCTCAGCCGGTGCCAACG

CCGCAGCCGCCTGAGTCCTCACCGCCGCCTCTGCCGCCGCCGCAGCAGCAGCAGTGCTCTCAGCCCGGCACTGCCGCCTCCCCGGCGGGTGCCCCGCTTT

CCTGCGGGCCTGGGGGCCGGCGTGCCGAGCCATGCCCCGGGCTGCCGGCGGTGGCCATGGGGCGGCACGGCGGCGGCGGCGGCGACAGCGGTAAGATCGT

GATCAACGTGGGCGGCGTGCGCCATGAGACGTACCGCTCCACGTTGCGCACCCTGCCAGGGACCAGACTGGCCGGGCTGACCGAGCCCGAGGCGGCCGCG

CGCTTTGACTACGACCCGGGCACGGACGAGTTCTTCTTCGACCGTCACCCGGGCGTCTTCGCCTACGTGCTCAACTACTACCGCACCGGCAAACTGCACT

GCCCGGCCGACGTGTGCGGGCCGCTCTTCGAGGAGGAGCTGGGCTTCTGGGGCATAGACGAGACGGACGTGGAGGCCTGCTGCTGGATGACCTATCGCCA

GCACCGTGACGCTGAGGAGGCACTGGACTCTTTCGAGGCCCCGGACTCCTCGGCCAACGCCAACGCCAACGCCGGAGGCGCGCACGATGCGGGACTGGAC

GACGAGGCGGGCGCAGGAGGCGGCGGCCTGGACGGGGCAGGCGGCGAGCTCAAGCGTCTGTGTTTTCAGGACGCGGGCGGAGGTGCCGGAGGACCTGCCG

GGGGCGCGGGCGGCGCGGGCGGCACCTGGTGGCGGCGCTGGCAGCCCCGTGTGTGGGCGCTTTTTGAGGACCCCTACTCGTCGCGGGCTGCCAGG - UN

I35285 - TATGTGGCCTTCGCCTCCCTATTCTTTATCCTCATCTCCATCACCACCTTCTGCCTGGAGACACACGAGGGCTTCATCCACATCAGCAACA

AGACGGTGACGCAGGCCTCCCCAATCCCTGGGGCTCCCCCGGAGAATATCACCAACGTGGAGGTGGAGACGGAACCCTTCTTGACCTACGTGGAAGGCGT

GTGTGTGGTCTGGTTCACCTTTGAGTTTCTCATGCGGGTCACCTTCTGCCCAGATAAGGTGGAGTTTCTCAAAAGCAGCCTGAACATCATCGACTGCGTG

GCCATCTTGCCCTTCTACTTGGAAGTGGGCCTGTCAGGTCTCAGCTCCAAAGCTGCCAAGGACGTGCTGGGCTTCCTGCGTGTCGTCCGCTTCGTGCGCA

TCCTTCGTATCTTCAAGCTGACCCGTCACTTCGTGGGGCTGCGTGTGCTGGGCCACACGCTCCGGGCCAGCACCAACGAATTCTTGTTACTCATCATCTT

CCTGGCTCTGGGGGTCCTCATCTTTGCCACCATGATCTACTATGCCGAACGCATCGGGGCTGATCCTGACGACATCCTGGGCTCCAACCACACCTACTTC

AAGAACATCCCCATCGGCTTCTGGTGGGCTGTGGTCACCATGACGACACTGGGCTATGGAGACATGTATCCCAAGACGTGGTCTGGGATGCTGGTTGGGG

CACTGTGTGCCCTGGCTGGTGTGCTGACCATTGCCATGCCCGTGCCTGTCATTGTCAACAACTTCGGCATGTACTATTCACTGGCTATGGCCAAGCAGAA

ATTGCCAAAGAAGAAAAACAAACATATTCCCAGGCCCCCGCAGCCTGGCTCACCCAACTACTGCAAGCCTGACCCCCCGCCTCCACCCCCACCACACCCC

CACCACGGCAGCGGTGGCATAAGCCCACCGCCGCCCATCACCCCTCCTTCCATGGGGGTGAATGTGGCCGGGGCCTACCCACCTGGACCCCACACACACC

CCGGGCTGCTCAGGGGTGGTGCTGGGGGCCTGGGAATCATGGGATTGCCTCCTCTGCCAGCCCCTGGTGAGCCCTGCCCATTGGCTCAAGAAGAGGTGAT

TGAAACCAACAGGGCAG - UNI18821 - - UNI31083 - TAGACCCCCGTCCCAATGGAGACCCTGCAGCAGCCGCACTGGCCCATGAGGACTGC

CCTGCCATCGACCAGCCAGCCATGTCTCCAGAAGACAAGAGCCCAATCACTCCCGGAAGCCGGGGTCGCTACAGCCGGGACCGAGCTTGCTTCCTTGTCA

CAGACTATGCCCCTTCCCCTGATGGCTCCATCCGAAAAG - UNI18821 - CTCTTGTCACCGCCTGAGACCTCGCGAGACCCTCGGGTTCCCCCTGT

CCCTTCCCCCCAG - UNI33161 - GTTACGAGAAGTCCCGCAGCCTGAGCAGCATTGTGGGCCTGAGCGGGGTGTCCCTGCGCCTCGCGCCCCTCGC

CACCCCCCCTGGCTCTCCCCGGGCCACGCGCCGAGCTCCCCCGACCCTGCCCTCCATCCTCTAGCGCAGCCCTCCCCCCTGTGGGGGGACTGGGGGTGAT

GGGAAGGTGAAAAGGAGCTGGGAGTAGGGCTGGGGAAAGGGTTCTTTTTTTAAAAAAAAAAAAGTCAATAATATGCAAAAGAGACGATGCCAGCAGACAC

Translation
MLSSVCVWSFRGRQGTGKQQPQPVPTPQPPESSPPPLPPPQQQQCSQPGTAASPAGAPLSCGPGGRRAEPCPGLPAVAMGRHGGGGGDSGKIVINVGGVR

HETYRSTLRTLPGTRLAGLTEPEAAARFDYDPGTDEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELGFWGIDETDVEACCWMTYRQHRDAEEA

LDSFEAPDSSANANANAGGAHDAGLDDEAGAGGGGLDGAGGELKRLCFQDAGGGAGGPAGGAGGAGGTWWRRWQPRVWALFEDPYSSRAAR - UNI352

85 - YVAFASLFFILISITTFCLETHEGFIHISNKTVTQASPIPGAPPENITNVEVETEPFLTYVEGVCVVWFTFEFLMRVTFCPDKVEFLKSSLNIID

CVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGADPDDILGSNHT

YFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKNKHIPRPPQPGSPNYCKPDPPPPPPP

HPHHGSGGISPPPPITPPSMGVNVAGAYPPGPHTHPGLLRGGAGGLGIMGLPPLPAPGEPCPLAQEEVIETNRAV - UNI18821 - - UNI31083 

- VDPRPNGDPAAAALAHEDCPAIDQPAMSPEDKSPITPGSRGRYSRDRACFLVTDYAPSPDGSIRKA - UNI18821 - ALVTA - UNI33161 -

 
Transcript ENSMUST00000107907
Sequence
AGCTTTCTGTGCAACCCCACCTCCTCTAGCTAGGCTGGGTCGGAGTCTGCCTAGCCGTGGCCCCGCCCAGTCGCTCAGCCCAATCAGCTCGTGCCCTCCC

TCCACCTGCCCAATCACACCCTCCCATCCATTCATCGCCTCCTCCTGTCCAATCACGTCTGCCTCTCTACCCGGGCCCCGCCCCCGAGACCCTGCCCCCT

CCCAGCCCCGCCTCCCTGTCCAATGCTCAGTTCAGTGTGCGTCTGGTCGTTCCGCGGGCGCCAGGGGACCGGCAAGCAGCAGCCTCAGCCGGTGCCAACG

CCGCAGCCGCCTGAGTCCTCACCGCCGCCTCTGCCGCCGCCGCAGCAGCAGCAGTGCTCTCAGCCCGGCACTGCCGCCTCCCCGGCGGGTGCCCCGCTTT

CCTGCGGGCCTGGGGGCCGGCGTGCCGAGCCATGCCCCGGGCTGCCGGCGGTGGCCATGGGGCGGCACGGCGGCGGCGGCGGCGACAGCGGTAAGATCGT

GATCAACGTGGGCGGCGTGCGCCATGAGACGTACCGCTCCACGTTGCGCACCCTGCCAGGGACCAGACTGGCCGGGCTGACCGAGCCCGAGGCGGCCGCG

CGCTTTGACTACGACCCGGGCACGGACGAGTTCTTCTTCGACCGTCACCCGGGCGTCTTCGCCTACGTGCTCAACTACTACCGCACCGGCAAACTGCACT

GCCCGGCCGACGTGTGCGGGCCGCTCTTCGAGGAGGAGCTGGGCTTCTGGGGCATAGACGAGACGGACGTGGAGGCCTGCTGCTGGATGACCTATCGCCA

GCACCGTGACGCTGAGGAGGCACTGGACTCTTTCGAGGCCCCGGACTCCTCGGCCAACGCCAACGCCAACGCCGGAGGCGCGCACGATGCGGGACTGGAC

GACGAGGCGGGCGCAGGAGGCGGCGGCCTGGACGGGGCAGGCGGCGAGCTCAAGCGTCTGTGTTTTCAGGACGCGGGCGGAGGTGCCGGAGGACCTGCCG

GGGGCGCGGGCGGCGCGGGCGGCACCTGGTGGCGGCGCTGGCAGCCCCGTGTGTGGGCGCTTTTTGAGGACCCCTACTCGTCGCGGGCTGCCAGG - UN

I35285 - TATGTGGCCTTCGCCTCCCTATTCTTTATCCTCATCTCCATCACCACCTTCTGCCTGGAGACACACGAGGGCTTCATCCACATCAGCAACA

AGACGGTGACGCAGGCCTCCCCAATCCCTGGGGCTCCCCCGGAGAATATCACCAACGTGGAGGTGGAGACGGAACCCTTCTTGACCTACGTGGAAGGCGT

GTGTGTGGTCTGGTTCACCTTTGAGTTTCTCATGCGGGTCACCTTCTGCCCAGATAAGGTGGAGTTTCTCAAAAGCAGCCTGAACATCATCGACTGCGTG

GCCATCTTGCCCTTCTACTTGGAAGTGGGCCTGTCAGGTCTCAGCTCCAAAGCTGCCAAGGACGTGCTGGGCTTCCTGCGTGTCGTCCGCTTCGTGCGCA

TCCTTCGTATCTTCAAGCTGACCCGTCACTTCGTGGGGCTGCGTGTGCTGGGCCACACGCTCCGGGCCAGCACCAACGAATTCTTGTTACTCATCATCTT

CCTGGCTCTGGGGGTCCTCATCTTTGCCACCATGATCTACTATGCCGAACGCATCGGGGCTGATCCTGACGACATCCTGGGCTCCAACCACACCTACTTC

AAGAACATCCCCATCGGCTTCTGGTGGGCTGTGGTCACCATGACGACACTGGGCTATGGAGACATGTATCCCAAGACGTGGTCTGGGATGCTGGTTGGGG

CACTGTGTGCCCTGGCTGGTGTGCTGACCATTGCCATGCCCGTGCCTGTCATTGTCAACAACTTCGGCATGTACTATTCACTGGCTATGGCCAAGCAGAA

ATTGCCAAAGAAGAAAAACAAACATATTCCCAGGCCCCCGCAGCCTGGCTCACCCAACTACTGCAAGCCTGACCCCCCGCCTCCACCCCCACCACACCCC

CACCACGGCAGCGGTGGCATAAGCCCACCGCCGCCCATCACCCCTCCTTCCATGGGGGTGAATGTGGCCGGGGCCTACCCACCTGGACCCCACACACACC

CCGGGCTGCTCAGGGGTGGTGCTGGGGGCCTGGGAATCATGGGATTGCCTCCTCTGCCAGCCCCTGGTGAGCCCTGCCCATTGGCTCAAGAAGAGGTGAT

TGAAACCAACAGGGCAG - UNI18821 - - UNI31083 - ACCCCCGTCCCAATGGAGACCCTGCAGCAGCCGCACTGGCCCATGAGGACTGCCCT

GCCATCGACCAGCCAGCCATGTCTCCAGAAGACAAGAGCCCAATCACTCCCGGAAGCCGGGGTCGCTACAGCCGGGACCGAGCTTGCTTCCTTGTCACAG

ACTATGCCCCTTCCCCTGATGGCTCCATCCGAAAAG - UNI18821 - - UNI33161 - GTTACGAGAAGTCCCGCAGCCTGAGCAGCATTGTGGG

CCTGAGCGGGGTGTCCCTGCGCCTCGCGCCCCTCGCCACCCCCCCTGGCTCTCCCCGGGCCACGCGCCGAGCTCCCCCGACCCTGCCCTCCATCCTCTAG

CGCAGCCCTCCCCCCTGTGGGGGGACTGGGGGTGATGGGAAGGTGAAAAGGAGCTGGGAGTAGGGCTGGGGAAAGGGTTCTTTTTTTAAAAAAAAAAAAG

TCAATAATATGCAAAAGAGACGATGCCAGCAGACACCCCCGGGGCCTCTCACTCCCCATACACTAGAAAACCCAGGATAGAGGGGGCAGGGCCGGAGCCT

GTACCCCATCTCCCTCCCCCTTCCAAAAAAAAAAAAAAAAGCAAACCTCAGGTCTCCATGAGCCATAGGACACCCCTCCCATCGACTCCTGTAAATAACT

AAAAGCTGATTCCATCTTGGGGCACCCACTCCAGTTTGCATGCCTCCCCGACCCCCTCTTCAGCAATAAGCCGCCAGGAGCTGTGTGCAAAGAGTTGGAG

GGGAGGCTGCTGGGAGCCTCTAAGGTCGGAGCTAGCATTTTTAGGGGTCTTCCTGGTCACCCGCCCCCCAAAGGGCAACCCACCCATCACTAATTGATTC

AGGAAAAACAAAAACCTCTAGGAACACGTAGGAAAAGGAAGACAGGTTAATCAGCCGCAGCCCCGAGGAGCTCAGCTTGGGGGTGGGGGGGTTCTGCCAG

CTGCTCTTGGGCTTGGAGGACGCCAGCTGGTGCATTCCACCCACGCCCGCCTCCAGGGATCTGCTCCCTCTATTCGCTGCATGGACTTGGCCCTCCAGGC

CCAGAACCCTCTACCCACTGCAGTCTCCACTCTATCCCAAGAGGTGAGACTAGTACCCTAGACTTAAGGAGACAGAACCTGGCACCCTGCACTCCCACAC

CCCACGGACTCCGGCGCCCCCCACTCCTCACCTCCATCACTCCATCCATCCCCCACTGGCCTGGACTGCACCACAGAGTTTTTCCACTCTTCCCTTGCAC

CTCCGCTCACTTCCAGCCTTCGGGGTTCTGACAGTCCTCAAGACCCTGACATTGCCTAGACACCCCTATATCCCCAACCCCAGACGGCCCCAACTCCCTG

ACATCACACTCCTCTGTCCCCTGGCGCCTCTGGCGCAAGACCTTCCCGGACAAGCTCCGTCTGTCTGATTACAGAGAGCTCCCATCCCATTCCAGTATTA

CTGTCTAGGCAGCCCCCTCCTCACCGCCCTCTCCCCCCCCACCCCATGGTGCCAAAACACACTTTCTTCATGGCCACCAGAGTTTCCCAGAGCGTGGGAC

TCCCGTTCCCTCTTCGTGTGCTGAAGTTTGCAAAGTGCACAGACGACCAAGTGTTTTAAACTTGTGTGCTCTTTGCAGGCTCACACCCGGCTGGTGCGTC

CTGGCAGCGCAGCAGTTGGGTGTTGCCACTGAAAGCAAGTCTAAGACAGGATGGGACCCAATGCTAAAAGCGCTTGCTTAATGTGCTAAGGTCCCAGGGT

TCAAACTCCAGCAACCCCTCTTCCCCTACTGGTGGGCAAAGAGGACATACCCACCTCGGCTAGGATCTCAGCCTGCCCTTCCCAGCTTCCTTGCCCACTA

CGTGCCACATTCTCGGATGGAAAACTTTCTCAAATCTCGTCTTGGCTCCAGGATGCTACCTCCCCCAAGCCCAGAGACCACACTGGTCCCAGAATCCTTA

GCGAACTATCCCCTTTGGAGCTGGGTGGTCGGCAGAATTAGCAATCCCTTGTTCCCACCGCCTCAGGGAAACCTCCCGCTGTCACCAGAGTTGTCGGTGG

GGGTGTCCTTGGGCCCAATTCTTGATGCAACAATTCCTATGCAAGGGACATTTTGAGTCCCTCCCGCACCCCCCGCCTTCCCTCGGGACCTTAAACTCTG

GTGAGACAGGGGTTGAGGAGTGGGGTGGGATCTGGTAGGGGCAGGGCAAAGGGCTAGGGGACTCTAGACACCAGGGTATGGGCTGAGGACTCCTAATATT

GCCAAAGGATTCAACTTATTTAACAACCCCTATTATCCCCGCCCCCCTGTCCCTTAAAAGAGACGAATGGGGCGGGGAAAGGGGTAAGAGTCCTTTTTGA

AGGGTACCAACCACTTCCCACTGTTTTCCCCTGCTCTCCAGTTCCCTACACATATCCAGCTTTTTAGTTAAGCATTTTTAAAAAGCTACCGTCATTATAA

ACGTCTACAAAACGTGATTTTTGCCCCTCCACATCCCCCAATTTACCAAACAGTGTGGGATTAGGGGAGGGAGAGCCAGGTCCTGGTCTCCCTTTTCCCC

ACGGCCGCCAGGGTGCCTGCAACTGCACGCATGCGCTGCATGACGCGCCCCCCCCACATACACACGCATGCGTCGCGCACCCCTCCTGCGCTGGGGGGGG

ACGCGCGGACTTGGGGGCGGGGCGATGGGGAGGAATGATTGGCAGAGGGGAAGGGGGTCTTTCTGAGCTCAATGGCTCCTCTCCTTCCCCACACACTCAC

AGCAATAAGTTTCTCTACTTCTAGTGGGCGGACGGGCCTAGCCTGACCTGGCGCGGGAGGGGCTGGCCAATGGGCGCTCTCAGGGATGGGGGCGGGTCCT

GAGTCTGGGGGAGGGGAGGTCTGCAACTCTGGTGCTAATGGCGGGTCTTCCTGGCCCACCCGCAGGCAGGGAGGAAGGAGTCGGCAGGCTCCTCCCCCAA

GCCTCCCCCACGCCCACCCAGGGTGCATGAACCACCCACGCAGAAGCTGCCGCATGTCAACCCTCCCCCCCACAAAGAAACAGTGTCATGCCCCTTCCCA

CCTGCCCTCCCACTCCCCAGCCCAATAAATGATACCTTTTCATTTACAA
Translation
MLSSVCVWSFRGRQGTGKQQPQPVPTPQPPESSPPPLPPPQQQQCSQPGTAASPAGAPLSCGPGGRRAEPCPGLPAVAMGRHGGGGGDSGKIVINVGGVR

HETYRSTLRTLPGTRLAGLTEPEAAARFDYDPGTDEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELGFWGIDETDVEACCWMTYRQHRDAEEA

LDSFEAPDSSANANANAGGAHDAGLDDEAGAGGGGLDGAGGELKRLCFQDAGGGAGGPAGGAGGAGGTWWRRWQPRVWALFEDPYSSRAAR - UNI352

85 - YVAFASLFFILISITTFCLETHEGFIHISNKTVTQASPIPGAPPENITNVEVETEPFLTYVEGVCVVWFTFEFLMRVTFCPDKVEFLKSSLNIID

CVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGADPDDILGSNHT

YFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKNKHIPRPPQPGSPNYCKPDPPPPPPP

HPHHGSGGISPPPPITPPSMGVNVAGAYPPGPHTHPGLLRGGAGGLGIMGLPPLPAPGEPCPLAQEEVIETNRAD - UNI18821 - - UNI31083 

- DPRPNGDPAAAALAHEDCPAIDQPAMSPEDKSPITPGSRGRYSRDRACFLVTDYAPSPDGSIRKG - UNI18821 - - UNI33161 - GYEKSR

SLSSIVGLSGVSLRLAPLATPPGSPRATRRAPPTLPSIL
Transcript ENSMUST00000107906
Sequence
ATGCTCAGTTCAGTGTGCGTCTGGTCGTTCCGCGGGCGCCAGGGGACCGGCAAGCAGCAGCCTCAGCCGGTGCCAACGCCGCAGCCGCCTGAGTCCTCAC

CGCCGCCTCTGCCGCCGCCGCAGCAGCAGCAGTGCTCTCAGCCCGGCACTGCCGCCTCCCCGGCGGGTGCCCCGCTTTCCTGCGGGCCTGGGGGCCGGCG

TGCCGAGCCATGCCCCGGGCTGCCGGCGGTGGCCATGGGGCGGCACGGCGGCGGCGGCGGCGACAGCGGTAAGATCGTGATCAACGTGGGCGGCGTGCGC

CATGAGACGTACCGCTCCACGTTGCGCACCCTGCCAGGGACCAGACTGGCCGGGCTGACCGAGCCCGAGGCGGCCGCGCGCTTTGACTACGACCCGGGCA

CGGACGAGTTCTTCTTCGACCGTCACCCGGGCGTCTTCGCCTACGTGCTCAACTACTACCGCACCGGCAAACTGCACTGCCCGGCCGACGTGTGCGGGCC

GCTCTTCGAGGAGGAGCTGGGCTTCTGGGGCATAGACGAGACGGACGTGGAGGCCTGCTGCTGGATGACCTATCGCCAGCACCGTGACGCTGAGGAGGCA

CTGGACTCTTTCGAGGCCCCGGACTCCTCGGCCAACGCCAACGCCAACGCCGGAGGCGCGCACGATGCGGGACTGGACGACGAGGCGGGCGCAGGAGGCG

GCGGCCTGGACGGGGCAGGCGGCGAGCTCAAGCGTCTGTGTTTTCAGGACGCGGGCGGAGGTGCCGGAGGACCTGCCGGGGGCGCGGGCGGCGCGGGCGG

CACCTGGTGGCGGCGCTGGCAGCCCCGTGTGTGGGCGCTTTTTGAGGACCCCTACTCGTCGCGGGCTGCCAGG - UNI35285 - TATGTGGCCTTCG

CCTCCCTATTCTTTATCCTCATCTCCATCACCACCTTCTGCCTGGAGACACACGAGGGCTTCATCCACATCAGCAACAAGACGGTGACGCAGGCCTCCCC

AATCCCTGGGGCTCCCCCGGAGAATATCACCAACGTGGAGGTGGAGACGGAACCCTTCTTGACCTACGTGGAAGGCGTGTGTGTGGTCTGGTTCACCTTT

GAGTTTCTCATGCGGGTCACCTTCTGCCCAGATAAGGTGGAGTTTCTCAAAAGCAGCCTGAACATCATCGACTGCGTGGCCATCTTGCCCTTCTACTTGG

AAGTGGGCCTGTCAGGTCTCAGCTCCAAAGCTGCCAAGGACGTGCTGGGCTTCCTGCGTGTCGTCCGCTTCGTGCGCATCCTTCGTATCTTCAAGCTGAC

CCGTCACTTCGTGGGGCTGCGTGTGCTGGGCCACACGCTCCGGGCCAGCACCAACGAATTCTTGTTACTCATCATCTTCCTGGCTCTGGGGGTCCTCATC

TTTGCCACCATGATCTACTATGCCGAACGCATCGGGGCTGATCCTGACGACATCCTGGGCTCCAACCACACCTACTTCAAGAACATCCCCATCGGCTTCT

GGTGGGCTGTGGTCACCATGACGACACTGGGCTATGGAGACATGTATCCCAAGACGTGGTCTGGGATGCTGGTTGGGGCACTGTGTGCCCTGGCTGGTGT

GCTGACCATTGCCATGCCCGTGCCTGTCATTGTCAACAACTTCGGCATGTACTATTCACTGGCTATGGCCAAGCAGAAATTGCCAAAGAAGAAAAACAAA

CATATTCCCAGGCCCCCGCAGCCTGGCTCACCCAACTACTGCAAGCCTGACCCCCCGCCTCCACCCCCACCACACCCCCACCACGGCAGCGGTGGCATAA

GCCCACCGCCGCCCATCACCCCTCCTTCCATGGGGGTGAATGTGGCCGGGGCCTACCCACCTGGACCCCACACACACCCCGGGCTGCTCAGGGGTGGTGC

TGGGGGCCTGGGAATCATGGGATTGCCTCCTCTGCCAGCCCCTGGTGAGCCCTGCCCATTGGCTCAAGAAGAGGTGATTGAAACCAACAGGGCAG - UN

I18821 - - UNI31083 - TAGACCCCCGTCCCAATGGAGACCCTGCAGCAGCCGCACTGGCCCATGAGGACTGCCCTGCCATCGACCAGCCAGCCA

TGTCTCCAGAAGACAAGAGCCCAATCACTCCCGGAAGCCGGGGTCGCTACAGCCGGGACCGAGCTTGCTTCCTTGTCACAGACTATGCCCCTTCCCCTGA

TGGCTCCATCCGAAAAG - UNI18821 - - UNI33161 - GTTACGAGAAGTCCCGCAGCCTGAGCAGCATTGTGGGCCTGAGCGGGGTGTCCCTG

CGCCTCGCGCCCCTCGCCACCCCCCCTGGCTCTCCCCGGGCCACGCGCCGAGCTCCCCCGACCCTGCCCTCCATCCTCTAGCGCAGCCCTCCCCCCTGTG

GGGGGACTGGGGGTGATGGGAAGGTGAAAAGGAGCTGGGAGTAGGGCTGGGGAAAGGGTTCTTTTTTT
Translation
MLSSVCVWSFRGRQGTGKQQPQPVPTPQPPESSPPPLPPPQQQQCSQPGTAASPAGAPLSCGPGGRRAEPCPGLPAVAMGRHGGGGGDSGKIVINVGGVR

HETYRSTLRTLPGTRLAGLTEPEAAARFDYDPGTDEFFFDRHPGVFAYVLNYYRTGKLHCPADVCGPLFEEELGFWGIDETDVEACCWMTYRQHRDAEEA

LDSFEAPDSSANANANAGGAHDAGLDDEAGAGGGGLDGAGGELKRLCFQDAGGGAGGPAGGAGGAGGTWWRRWQPRVWALFEDPYSSRAAR - UNI352

85 - YVAFASLFFILISITTFCLETHEGFIHISNKTVTQASPIPGAPPENITNVEVETEPFLTYVEGVCVVWFTFEFLMRVTFCPDKVEFLKSSLNIID

CVAILPFYLEVGLSGLSSKAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGADPDDILGSNHT

YFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKNKHIPRPPQPGSPNYCKPDPPPPPPP

HPHHGSGGISPPPPITPPSMGVNVAGAYPPGPHTHPGLLRGGAGGLGIMGLPPLPAPGEPCPLAQEEVIETNRAV - UNI18821 - - UNI31083 

- VDPRPNGDPAAAALAHEDCPAIDQPAMSPEDKSPITPGSRGRYSRDRACFLVTDYAPSPDGSIRKG - UNI18821 - - UNI33161 - GYEKS

RSLSSIVGLSGVSLRLAPLATPPGSPRATRRAPPTLPSIL

For any suggestions or comments, please send an email to unitrap@crg.es